SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004453584.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004453584.1.11602
Domain Number 1 Region: 352-612
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.23e-76
Family Protein kinases, catalytic subunit 0.000000000354
Further Details:      
 
Domain Number 2 Region: 6-146
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-45
Family Pleckstrin-homology domain (PH domain) 0.000048
Further Details:      
 
Domain Number 3 Region: 234-382
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-32
Family SH2 domain 0.00000156
Further Details:      
 
Domain Number 4 Region: 175-256
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-17
Family SH3-domain 0.0000619
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004453584.1.11602
Sequence length 620
Comment PREDICTED: tyrosine-protein kinase ITK/TSK [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVSKY
HPNFWMDGRWRCCAQVEKLAVGCAEYDPTKNASKKPLPPTPEDNRRSLRESEETLVIALY
DYQTNDPQELTLQRNEEYYLMDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCSWRQKAPVTAGLRYGKWVIDP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFVEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLFAMESLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASSHIYQIMNHCWKERPE
DRPPFSSLLGQLAEIAEAGL
Download sequence
Identical sequences ENSDNOP00000008707 XP_004453584.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]