SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004456317.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004456317.1.11602
Domain Number 1 Region: 102-234
Classification Level Classification E-value
Superfamily TNF-like 3.11e-37
Family TNF-like 0.0000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004456317.1.11602
Sequence length 243
Comment PREDICTED: complement C1q tumor necrosis factor-related protein 5 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MRPLLALLLLGLAAGSAPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRDGRDGRDGAPG
APGERGEGGRPGLPGPRGEPGPRGEVGPAGATGPAGECSVPPRSAFSAKRSESRVPPPSD
APLPFDRVLVNEQGHYDAATGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQ
FFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSP
VFA
Download sequence
Identical sequences XP_004456317.1.11602 ENSDNOP00000016197 ENSDNOP00000016197 9361.ENSDNOP00000016197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]