SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004457559.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004457559.1.11602
Domain Number 1 Region: 117-261
Classification Level Classification E-value
Superfamily TNF-like 1.58e-37
Family TNF-like 0.000000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004457559.1.11602
Sequence length 261
Comment PREDICTED: CD40 ligand [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MIETYSQTSPRSVTSGPSVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKRIQKCNKGEGSLSLLNCEEIRSQFEAFVKDIMLNEEGKKKEQHFEMQRGDQDP
QIAAHVVSDASSKTGSVLQWAKKGYYTMSNNLVTLKNGKQLVIQREGLYYVYTQVTFCSN
RETLGQTPFIASLCLRSTSGSERILLRAANTHSSSKPCGQQSIHLGGVFELQSGASVFVN
VTDPSQVNHGTGFTSFGLLKL
Download sequence
Identical sequences A0A0U5JY63
ENSDNOP00000025270 XP_004457559.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]