SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004463222.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004463222.1.11602
Domain Number 1 Region: 99-256
Classification Level Classification E-value
Superfamily TNF-like 1.13e-38
Family TNF-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004463222.1.11602
Sequence length 256
Comment PREDICTED: tumor necrosis factor ligand superfamily member 15 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MVGDLGLDFGESASMEMLPEEGIHRPKARGALEARSGSLLWALTCCMVALPLLTGLTTYV
LVGQLRVQGEACLFKTPKGQEFGPSPQQAYAPPRTDGDKPRAHLTVVRQTSTQHLKNQFP
ALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQITFRGTASECGKINQQSQLNKPD
SIIVIVTKVTDSYPLPTQLLTGTKSVCEIGTNWFQPIYLGAVFSLQEGDKLVVNVSDISL
VDYTKEDKTFFGAFLL
Download sequence
Identical sequences A0A0U5J867
ENSDNOP00000030477 XP_004463222.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]