SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004465536.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004465536.1.11602
Domain Number 1 Region: 27-65,297-379
Classification Level Classification E-value
Superfamily SET domain 2.94e-27
Family Viral histone H3 Lysine 27 Methyltransferase 0.091
Further Details:      
 
Weak hits

Sequence:  XP_004465536.1.11602
Domain Number - Region: 108-137
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000575
Family MYND zinc finger 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004465536.1.11602
Sequence length 417
Comment PREDICTED: SET and MYND domain-containing protein 5 isoform X1 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MAASMCDVFSFCVGVAGPARVAVEVRFVSSAKGKGLFATHLIRKGETIFVERPLVAAQFL
WNALYRYRACDHCLRALEKAEENAQRLTGKPGQVLPHPELCTVRKDLHQNCPHCQVMYCS
AECRLAAAEQYHQVLCPGPSQEDPLHPLNKLQEAWRSVHYPPETASIMLMARMVATVKQA
KDKERWIRLFSQFCNKTANEEEEIVHKLLGDKFKGQLELLRRLFTEALYEEALSQWFTPD
GFRSLFALVGTNGQGIGTSSLSQWVHACDALELKPQDRERLDAFIDQLYKDIEAATGEFL
NCEGSGLFMLQSCCNHSCVPNAETSFPENNFLLHVTALEDIKPGEEICISYLDCCQRERS
RHSRHKILRENYLFVCSCPKCLAEADEPNVTSEEEEEEEEEEGEAEDAELGDEMTDV
Download sequence
Identical sequences XP_004465536.1.11602 ENSDNOP00000018787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]