SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004466898.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004466898.1.11602
Domain Number 1 Region: 134-271
Classification Level Classification E-value
Superfamily TNF-like 8.03e-38
Family TNF-like 0.00028
Further Details:      
 
Domain Number 2 Region: 47-56
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000123
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  XP_004466898.1.11602
Domain Number - Region: 6-63
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0418
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004466898.1.11602
Sequence length 271
Comment PREDICTED: tumor necrosis factor ligand superfamily member 6 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MQRPLNYPYPQIFWVDSSASSPWAPPGPVLPCPASGPGRPGQRRPPPPPPPPPPPPPLPP
PPPKRDHSTGLCLLMMFFMVLVALVGLGLGMFQIFHLQKELAELRESTSQRDLESSLEKQ
IGHPSPPAEKRELKKVAHLTGNPNSRSIPLEWEDTYGIALVSGVKYKKGGLMINDTGLYF
VYSKVYFRGQSCNNKPLSHKVYMRHSRYPQDLVLMEGKMMDYCTTGQMWARSSYLGAVFN
LTTADHLYVNVSELSLVSFEESKTFFGLYKL
Download sequence
Identical sequences ENSDNOP00000023744 XP_004466898.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]