SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004468355.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004468355.1.11602
Domain Number 1 Region: 116-245
Classification Level Classification E-value
Superfamily TNF-like 1.89e-38
Family TNF-like 0.000000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004468355.1.11602
Sequence length 248
Comment PREDICTED: complement C1q subcomponent subunit B [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MKTLWGGVLPLLLLSLPDASCAQSSCTGPATIPGTPGIPGRPGSDGQPGTPGIKGAKGLP
GLAGDHGEYGEKGDPGIPGNPGKVGPKGPVGPKGSPGPPGARGPKGESGDYKATQKIAFS
ATRTVTTPLRRDQTIRFDHVITNENNNYEPRSGKFTCKVPGLYYFTFHASSRGNLCVNLV
RGRERPQRVVAFCDFVHSSFQVTTGGVVLKLGLGENVFLQATDRNSLLGLDGANSIFSGF
LLFPDAEA
Download sequence
Identical sequences ENSDNOP00000022645 XP_004468355.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]