SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004470151.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004470151.1.11602
Domain Number 1 Region: 53-523
Classification Level Classification E-value
Superfamily Sema domain 1.44e-129
Family Sema domain 0.0000234
Further Details:      
 
Domain Number 2 Region: 1365-1494,1690-1878
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.69e-51
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 966-1055
Classification Level Classification E-value
Superfamily E set domains 6.11e-18
Family Other IPT/TIG domains 0.064
Further Details:      
 
Domain Number 4 Region: 1054-1157
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000127
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 
Domain Number 5 Region: 870-967
Classification Level Classification E-value
Superfamily E set domains 0.00000000000165
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 526-577
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000863
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 1154-1235
Classification Level Classification E-value
Superfamily E set domains 0.0000000784
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number 8 Region: 822-856
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000458
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004470151.1.11602
Sequence length 1909
Comment PREDICTED: plexin-A2 isoform X1 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MRAQRICLLALAPRRMEQRRPWPWAPEVDRWSVVLLSMVWVLLVPPVAGMHQFSTFHSEN
RDWTFNHLTVHHGTGAVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSE
ALTLTNNVNKLLIIDYSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKT
GTMYGVIVRSKGEDGKLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSL
IKIPSDTLALVSHFDIFYIYGFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRIVRLCK
DDPKFHSYVSLPFGCTRAGVEYRLLQAAYLAKPGDTLAQAFNISSQDDVLFAIFSKGQKQ
YHHPPDDSALCAFPIRAINLQIKERLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFC
GLDINQPLGGSTPVEGLTLYTTSRDRMTAVAAYVYNGYSVVFVGTKSGKLKKIRADGPPH
GGIQYEMVSVLKDGSPILRDMAFSVDQRYLYVMSERQVTRVPVESCEQYTTCGECLSSGD
PHCGWCALHNMCSRRDKCHWAWEPNRFAASISQCMSLAVQPSSISVSEHSQRLSLVVSDA
PDLSAGVACAFGNLTEVEGQVSGSQVICISPGPKDVPVIPLDQDWFGLELQLRSKETGKI
FVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQLV
PTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLSIQGAVHRVPALRFNSSSVQCQNS
SYQYDGIDISNLAVDFAVVWNGNFIIDNPQDLKVHLYKCAAQRESCGLCLKADRKFECGW
CSGERRCTLHQHCTSPSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGL
DFSEIAHHVQVAGVPCTPLPGEYIIAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKS
HQQYTFVNPSVLSLSPIRGPESGGTMVTVVGHYLGAGSSVAVYLGNQTCEFYGRSMNEIV
CVSPPSSIGLGPVPVSVSVDRARVDNNLQFEYIDDPRVQRIEPEWSIASGHTPLTVTGFN
LDVIQEPRIRVKFNGKESVNVCKIVNTTTLTCLAPSLTTDYRPGLDTVERPDEFGFVFNN
VQSLLIYNDTKFIYYPNPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGGAKLNYTVLI
GETPCAVTVSETQLLCEPPNLTGQHKVMVHVGGMVFSPGSVSVISDSLLTLPAIVSIAAG
GSLLLIIVIIVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTS
DLDRSGIPYLDYRTYAMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLLNNKVFL
LTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIEKNLENKNHPKL
LLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSL
SEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQR
PRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSY
NIPASASISRTSISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKE
GDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQAD
RHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTS
EHRLGKDSPSNKLLYAKDIPSYKSWVERYYADITKLPAISDQDMNAYLAEQSRLHAAEFN
MLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLISAMSLES
Download sequence
Identical sequences XP_004470151.1.11602 ENSDNOP00000008745 ENSDNOP00000029056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]