SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004474466.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004474466.1.11602
Domain Number 1 Region: 273-341
Classification Level Classification E-value
Superfamily Leucine zipper domain 2.06e-21
Family Leucine zipper domain 0.0000427
Further Details:      
 
Weak hits

Sequence:  XP_004474466.1.11602
Domain Number - Region: 180-237
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00262
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004474466.1.11602
Sequence length 353
Comment PREDICTED: CCAAT/enhancer-binding protein alpha [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MESADFYEAEPRPPMSSHLQSPPHAPGSAAFGFPRGAGTAQPPAPSAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAAPLGGGGDYDYPGAPAGPGSAVMPG
GAHGTPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQ
PPPPPPPHPHPHPPSAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGS
AGLPGPGGALKGLAAAHPDLRGGVGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQ
RNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
Download sequence
Identical sequences XP_004474466.1.11602 ENSDNOP00000034260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]