SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004474471.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004474471.1.11602
Domain Number 1 Region: 65-156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 251-368
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000262
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 452-489
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 164-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000128
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 210-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 413-451
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004474471.1.11602
Sequence length 743
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MEKRAAAGPEGAAGARAQLAVVCLVNLFLAGRLSSAVPALGCCEDQMNQHGERXXXXXXX
XXXLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWVMLGPAAPPRQEALRLC
GSAIPSAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFLCDNGKCLP
GPWRCNSMDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAERRCDGSQDC
GDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLEL
RLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNA
TYQVKGYCLPWERPCGGGGDGGDAEDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYP
CEGGSGLCYAPTDRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQD
GSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRWAGPGAQRRGL
IPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLDRLWNRLFHRPRAPRGQ
IPLLTAARPSQTVLGDGLLQPAPEAPTPPTDTGSSAAAGEGPPGAPGHAPEVGPSVPPPG
LRDPERRPGDKDRKACGGPLVGSLAPVDTPREPCSAQDPQPPASATSDSLGPHPPEPLGV
CRGPPPPCSPTLEASDDEALLVC
Download sequence
Identical sequences XP_004474471.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]