SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004474534.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004474534.1.11602
Domain Number 1 Region: 35-289
Classification Level Classification E-value
Superfamily SET domain 3.43e-57
Family RuBisCo LSMT catalytic domain 0.0013
Further Details:      
 
Weak hits

Sequence:  XP_004474534.1.11602
Domain Number - Region: 306-395
Classification Level Classification E-value
Superfamily RuBisCo LSMT C-terminal, substrate-binding domain 0.0127
Family RuBisCo LSMT C-terminal, substrate-binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004474534.1.11602
Sequence length 440
Comment PREDICTED: SET domain-containing protein 4 isoform X1 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MQKGRGRTSRIRRRKLFRSSESRGVTESYKPEFIELMKWLKDRKFEDNNLKPAHFPGTGR
GLMSKTSLQVGQMIISLPESCLLTTDTVIRSYLGAYITKWKPPLSPLLALCTFLVSEKHA
GDQSPWKPYLEILPKAYTCPVCLEPKVVNLLPRPLRAKAQEQRTHVQEFFTSSRDFFSSL
QPLFSEAVESIFNYSAVLWAWCTVNTRAVYMRHRQREGFSTEPDTYALAPFLDLLNHSPD
VQVKAAFNEETHSYEIRTASRCRKREEVFICYGPHDNQRLFLEYGFVSVHNPHACVYVSR
DILVKYLPTTDKQMNKKISILKDHGFIENLTFGWDGPSWRLLTALKLLCLEAEEFTCWKK
VLLGEVISDTNEKTSLDISQKICSYFIEETNTMLQKVSRMKYEEVALINQLTLVETLWTE
ELKILQVSAEILNNLQTAFT
Download sequence
Identical sequences XP_004474534.1.11602 XP_004474535.1.11602 XP_012373458.1.11602 ENSDNOP00000033137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]