SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004481206.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_004481206.1.11602
Domain Number - Region: 25-113
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0107
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004481206.1.11602
Sequence length 128
Comment PREDICTED: uncharacterized protein C11orf52 homolog isoform X4 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MGNRLCCGESWSCPPHVRRKKKTGSQARQPPKQQPPPPQQQNGTKGPETPGHTYEQVLEH
PKSQDRRSPGLWPEESNLYYADIQVCSRTQPRSVRGMKHLRSENTTEYATLRFPRATPHY
DSKNGTLV
Download sequence
Identical sequences XP_004481206.1.11602 ENSDNOP00000032469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]