SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004481364.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004481364.1.11602
Domain Number 1 Region: 523-736
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000512
Further Details:      
 
Domain Number 2 Region: 326-448
Classification Level Classification E-value
Superfamily PH domain-like 8.13e-19
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 17-90
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000866
Family SH3-domain 0.002
Further Details:      
 
Domain Number 4 Region: 205-243
Classification Level Classification E-value
Superfamily WW domain 0.0000101
Family WW domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004481364.1.11602
Sequence length 737
Comment PREDICTED: rho GTPase-activating protein 9 isoform X1 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MLSGRWWPSTWGSLGPSRGSQLCALYAFTYTGEDGRQVNLAEGDRFLLLRKTNSDWWLAK
RLGAPSNSRPIFVPAAYVTEDSTPSRSQTTITPSQSLRTSGPKLFHSSLEELHLSKAAPG
RAQARTEQPPPLPPKITRSVSTASLSPLLRKPLQEGPSGRSLSQEDLLTEANANLAPPQP
LMSEPPVYCNLVDLRRCPRSPPPGPACPPLQRLDAWEQHLDPNSGRCFYVNSLTGCKSWK
PPRRTRSQETKPGSMEGIQTPSSGNGILQPQAKGSGSETGTAELLNLQGPSSLYRRRSSQ
PEPSDHPPASQAPRPPPQLLEDPHEVERSGLLNMTKIAQGGRKLRKSWGPSWVVLAGNSL
VFYREPPPTAPSSGWGPAGTRPESSVDLRGAALAHGRHLSSRRNVLHIRTVPGHEFLLQS
DDEAELRAWHGALRAVIERLDRENPLELRLSGSGPAELAELSAGEDDEEEPPLLPKSLLR
LSGRRSSSRSPEGTEQNRVRNKLKRLIAKRPSLQSLQERGLLRDQVFGCQLESLCQRDGD
TVPSFVQLCIAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYMFPEQPGQ
EGRLDLDSAEWDDIHVITGALKLFLRELPQPLVPTLLLPHFRAALALSESEQRLSQIQEL
IGSMPKPNHDTLRYLLEHLCRVIAHSDKNRMTPHNLGIVFGPTLFRPEQETSDLAAHALY
PGQLVQLMLTDFTNLFA
Download sequence
Identical sequences XP_004481364.1.11602 ENSDNOP00000013574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]