SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004520234.1.71379 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004520234.1.71379
Domain Number 1 Region: 129-578
Classification Level Classification E-value
Superfamily Sema domain 2.35e-128
Family Sema domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 1449-1577,1786-1947
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.31e-42
Family p120GAP domain-like 0.052
Further Details:      
 
Domain Number 3 Region: 939-1036
Classification Level Classification E-value
Superfamily E set domains 0.000000000000751
Family Other IPT/TIG domains 0.009
Further Details:      
 
Domain Number 4 Region: 581-632
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000445
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 1033-1121
Classification Level Classification E-value
Superfamily E set domains 0.0000000000751
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 6 Region: 1140-1222
Classification Level Classification E-value
Superfamily E set domains 0.0000000242
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.045
Further Details:      
 
Weak hits

Sequence:  XP_004520234.1.71379
Domain Number - Region: 894-928
Classification Level Classification E-value
Superfamily Plexin repeat 0.000144
Family Plexin repeat 0.004
Further Details:      
 
Domain Number - Region: 1250-1297
Classification Level Classification E-value
Superfamily E set domains 0.000742
Family Other IPT/TIG domains 0.088
Further Details:      
 
Domain Number - Region: 728-764
Classification Level Classification E-value
Superfamily Plexin repeat 0.00929
Family Plexin repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004520234.1.71379
Sequence length 2004
Comment plexin-A2 isoform X1 [Ceratitis capitata]; AA=GCF_000347755.2; RF=representative genome; TAX=7213; STAX=7213; NAME=Ceratitis capitata; AL=Scaffold; RT=Minor
Sequence
MRFIIWLVLAIVLHNLNSIESINTQTRHVEISSKIRDNCYKSTEIYARSLRNVVHIRKAA
LLNAEEDVAESSDGIIDGFKSASLKSALSGSDGGLSSSSIPFFGEEIRDYNANSVSSDAR
NFSNIITNVIHFDTPLNHLVVDTVTGRVFVGGVNYLYQLSPDLELHETVKTGPKNDSVEC
TVLDCPAHAARKPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIVEQDVPDAV
VANDASSSTVAFIAPGPPQPPTTYVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIAS
SAVTTGTRTFINSYAREGYLINYVYGFSSERFSYFLTTQLKHNYHSSPKEYITKIVRICQ
EDSNYYSYTEIPVDCITGGTKYNLVQAGYLGKPSVDLAGSLGITVQDDVLFAIFSVGDGN
ESTDNSALCIYSLKSIRRKFMQNIKSCFNGVGSRGLGFISPNMPCVPTKLQTIGEDFCGL
DVNSPLGGEQPISVVPVAKFNTQLTAVAATSTSGYTVVFIGTANGHLKKVVVESADSANE
YADIPIKIGSTINSDMHFDSRNLYIYVMSSNEVAKVKVYDCSDYSTCGECLGARDPYCGW
CSLENKCSPRSSCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLPQL
KENLVCAFTTEEKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTKDGPDL
VSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPSYR
SGPGFCPTINATGEGSEMLVAAGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLNAQ
LLGDTIYCDNMEFQYTSRSPNLTATFAVIWGGSKPLDNPHDIHVVIYRCRDMADSCGMCL
ALAEKYNCGWCSSTNTCEVEEQCNKNNEGKTDWLNRMETCPNPEIRLFYPKTGPWEGGTN
ITIRGINLGKNFSDIYSGVRIAGISCMPFQQFYVDTKEIVCNVDSPGVQLYRNGRIVVQI
GDYRGESKEDYEFVDPKITNFSPQYGPVSGGTHLRIIGKYLNAGSRIQAFINEHLRCDIL
SVDVTEAICRTAPSPGIIEGRLKMLFDNGQREFNEYNFKYVLDPTIDQVSSGPISQLKVP
RGIPAGGIEIVVTGTQFNYIQNPRMYVYYKNKIFYSQCKVKSATHMICYSPVIETDNDIL
NAENPVLLEYGFLMDNVLRVQNLSSIHNNHFELYPNPLYFNFEEDIKYYKSEYLTINGRN
LDRACKETDVVVRIGKGICNITSLSRQQLTCRPPPESATESSNESGPEVIVRIGQSLEYR
IGVLSYASPNLMHDLSKNVLLVIGVGTVAILMIFVALLVAYKKKTSESNRVLRNMQEQMD
ILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRTYAMKILFPNHEDHIVLQWER
PELLRKEKGLRLFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCT
DILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYMLF
RAVKGQVDKGPVDACTHEARYSLSEEKLIRQLIDFRPMTVYASIIQQPIFCNSIDMMPTH
TENVPVKVLDCDTIGQVKDKCVDTIYRNIPSSQRPRKDDLDLEWRTGASGRVILYDEDTT
SKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSNYNFSILSDKNEKCHKYETLNLSKYTSS
SPTFSRAGSPLNNDLHENGVKCWHLVKHHDSDIQKEGERVNKLVSEIYLTRLLATKGTLQ
KFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAILHGITDHEVVHTWKSNSLPLRFWV
NLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYRK
WVERYYRDIREMPSISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTLE
EDEFSQKQRLAFKLEQVHNMMSGE
Download sequence
Identical sequences W8BJM0
XP_004520234.1.71379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]