SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004526160.1.71379 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004526160.1.71379
Domain Number 1 Region: 406-626
Classification Level Classification E-value
Superfamily Bet v1-like 3.57e-29
Family STAR domain 0.0078
Further Details:      
 
Domain Number 2 Region: 60-177
Classification Level Classification E-value
Superfamily PH domain-like 6.42e-25
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004526160.1.71379
Sequence length 637
Comment collagen type IV alpha-3-binding protein isoform X1 [Ceratitis capitata]; AA=GCF_000347755.2; RF=representative genome; TAX=7213; STAX=7213; NAME=Ceratitis capitata; AL=Scaffold; RT=Minor
Sequence
MDYNVITETAARGGTSRSIYPSAISANSHTSNVNTLSSTPPMSMDTPTLRSIGTFPLDSS
SQSDDSENEYLDNNIELRGYLSKWTNYIYGWQPRYIVLKNGTLSYYKSESESDFGCRGAI
SLSKATIKAHDTDELRFDVVVNNYNNWCLRADTSEDRMHWVEVLQMYKEESGSTDTMSLR
RHGSTMSLQSNTISVASGSSLKKTQRNLREKVGEIETFKDILFGQIDTIQRYFDACVDVN
KATGKPLDLGDGLKPIDFKGESITFRATASGVLTTLQHCLDIIAESDDLWKRKLERELER
KKRTEEQNRKYKEEIEKIKRISYPGPDLEEGPHSTLPEDEFFDAVETGLEKIEEDMQIRA
KLKLQTQQSLTVANVPHKVQTEENDSNLEEFGTGGPARNHVLWSEIDRVCSEQLRYAREG
VGQGGNGWQIFADEGEIKMYKREEEVNGLVMDPLKAYHSVNGVTAREMCHYFFMPEFRNE
WETTLEDCTILEKISSDTFVFLQTHKRIWPASQRDALFWSHMRKITDGLDEDAIDMWVVC
NNSTEYSKQESKNSKCVRIFLTVILACQTLLPPGKTKNDKLSRDELTCKITYCSVVNPGG
WAPASALRAVYKREYPKFLKRFTGYVIDQCKDNPIMF
Download sequence
Identical sequences XP_004526159.1.71379 XP_004526160.1.71379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]