SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004534122.1.71379 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004534122.1.71379
Domain Number 1 Region: 658-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.75e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 202-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000452
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 396-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000249
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 706-740
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000457
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 630-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000366
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 6 Region: 514-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000004
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 7 Region: 576-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000131
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  XP_004534122.1.71379
Domain Number - Region: 480-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000236
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number - Region: 1306-1332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0222
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Domain Number - Region: 742-775
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0235
Family Classic zinc finger, C2H2 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004534122.1.71379
Sequence length 1333
Comment uncharacterized protein LOC101453355 [Ceratitis capitata]; AA=GCF_000347755.2; RF=representative genome; TAX=7213; STAX=7213; NAME=Ceratitis capitata; AL=Scaffold; RT=Minor
Sequence
MDRQTFQIQWIQGNRDDLKTAGGRLIVKPQVSPEDELLAHNLVSTTDEAAAYHLVSGAGD
DSNVPTEVDIDQIAAENLIFMSRECQMVTEIIDATTDESGTVVVSASDGIDCTEALQQAA
AAVMANQLAEEQEDAGGGFIDSFVDNTPQMVTEEVITDDWVQHQGEERVEIPADQIICSG
SQVLLDMEVPLPTVQDEYTALRPYPCDFCSRRFRKKTSLMNHIVAHQNDRPHLCKLCGSR
FFRRSDLINHLKAHADAPDPELDSEFMNFVAQEQQQLQAKQPNDHYYEQDWTTQINSLPR
SERSSRKPHNASGNSSSTSTSTTVGRGRISRIKPKEERYILDEPMRNEINESANIDNPSK
AYEDCQQLQASTAVVKFTQNQSPAHEQNFPIIDESKPFVCQQCGLAFAREKALLAHTKNH
RDDQPHECSHCNEMFWDANGLQEHLKTHQFEESNSEYDPEEAEAEETQSESESERLYGEF
YCSECGMSFHREELLRRHSKIHAKTVGECDVEKDKDRHCCNTCGETFAEALDLLAHAEIH
ARYPPFKCVLCGETFFEELTIKRHLQSLHPNDMTPNSCILCGKECRDRKALIKHAWDHSR
EKCHSCSKCGKNFHNKARLKRHMASHRDKSVICDVCQEEFPDGRTLSNHRHSHTNASGKM
FPCHECGKTFGSRSSQQIHVRIHTGERPYGCRFCWKAFADGGTLRKHERIHTGEKPYACS
VCARAFNQRVVLREHIRSHHSGLDVKRNTFFCTVCSMDMPSSPDLVQHLIQHSDMNTAMQ
RQPVTGPRKYKRRRKLKPHEIARLRRESQQNGNGSDIEISDFDMDNVDDLLGITDPNEAS
KAPTKSKRRNAKHNPNNSALINEGINGVILPDNDLLMERPRKPRYKSTGSNSDTLWQTKL
INTNSVLSNLENTLQSIDTLVVGSSVSGTTCHAEVEERKPRFKSGGDNNNGGSQRTQEVQ
INKNHNGNKGRKRTEKSTTSKVSRPRMIHTEKWPASSNEVGRKRSKTVVTQKEETDLDLL
CRTRTIVDDYEIISPATELPKQISSSPPRIKEEIIQNNHHEHYQQQRTMQYSTQRLSSSR
HVDLYDAQFLGGTSTLRKEAYEKFNPSIVNDLEEILRSPIKCDRTERHRFISESSTPFLE
EEQHNMIKIEPTSPDLREIVVGVSASGGVGVSGSSASGSSSDRRNARTPRSRASVINRKY
LEFESDLHSNGVTRAQKRNTTHTANSGNSRTKQARSNKREKKESSISNQRISTYSSTYSG
SLTTTNDSSFSSLSPTEGVSAVLSTSRPISTTATTTPVTAPQPERKVRYFECEMCSAVFP
DRAQLLDHVPIHI
Download sequence
Identical sequences W8BM76
XP_004534119.1.71379 XP_004534122.1.71379 XP_012160431.1.71379 XP_012160432.1.71379 XP_012160434.1.71379 XP_020716461.1.71379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]