SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004546186.1.88231 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004546186.1.88231
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 1.11e-99
Family Sema domain 0.00097
Further Details:      
 
Domain Number 2 Region: 1387-1510,1676-1860
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-35
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 858-949
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000178
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 4 Region: 1041-1121
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000955
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Domain Number 5 Region: 949-1022
Classification Level Classification E-value
Superfamily E set domains 0.00000000007
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 6 Region: 511-557
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000366
Family Plexin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004546186.1.88231
Sequence length 1900
Comment PREDICTED: plexin-D1 [Maylandia zebra]; AA=GCF_000238955.2; RF=representative genome; TAX=106582; STAX=106582; NAME=Maylandia zebra; ecotype=Mazinzi reef; AL=Scaffold; RT=Major
Sequence
MPPSIEIAVLLLGVLALETRRSASALHIQQAFASPNQTNNFVVDPVSRKVYLATVNTIYQ
LNGTLTAEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDREQGIVVACGS
VYQGFCELRKMDNISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNIKDLSRLFTYDINPSEDNVFKIKQ
EVKTKNKLSFVHAFIQKTYSYIAFNNDAKMGHKESQPNSILARICLDTENPRKSTGPESR
KLTESYIQMPLQCGFNGNFYNRVLSVYPTEIHAGDGKSPEPYLFGVFSKGDRKSALCAFK
FGDIEEEIRQGRRNCSNSPSSDVQVLDSVIQGSGSACIQKGNLVLQPEQLDCGAAHLQHP
LALQRPLRAIPLLEYPGLSSVSVDNVQNHTVVFLGTSNGRLRKLTLLPNMTTANQWMLKL
RANEAVHHIMTFDPNDSNFLYVMTSHHMLRVKVADCDQWKSCSDCLGAGDAHCGWCTLEN
RCTIQKECAQGLLARSWISMGEGPQQCPSMTLTPAEISISADIKDVGILINGSVPDLIGS
RVECEYEPGVSTVATVHLDSGPSQIQTCPLLPRKSYQPILPGKDHLTVSVAIKVNGTSVV
SGSFIIYDCERTGKIHPKTPCMSCLSTRWKCYWDQNKHLCVSSKDDANQNLLENAASCPS
LVSSEVPPSPSGMVQDFTLSLSNIQENEKLECDFGTEQRYEATWLNSTTVKCSGVTLSTN
QRSQIYHLNLRRRGAFIRHREDVFIDSPQPMKVEVYNCGVGSSDCSQCWGREDQGHLCGW
CDSICKPRDECQPIRDQCPNPEIHEISPLSGPVEGGTLLTVQGRNLGRRAKAVRVSIGDV
NCTLLPQFYTVSTELVCVTGRAADNRSDIVQVDVEQSGMGKSKETFSYLIPKLLSMEPER
GLRAGGTKVTINGEHLNIGSEVKVKVNTTQECIITKKTARTIECIMPPASQAHTDPVTVC
VEFENKTCEGPELSTTYTYERNPTITSIHPKMSFRSGGRNITVTGQGFDLVQSVTMQVVG
IGHSQCEVLTPSTIACRSPPSNQSQPTSVQFLLNGVLYTNDRPPFSSDTDDEEEEEEPHI
GHFPLEYVEDPQFFTANKEKLIKHHSGEQLTLIINKVPSDLELMPEEYSVMIGSYPCNIT
FHNDQLFHCTINGLSSSSERELPVFVQVGNFRRKVATVQLGGSEMAIVVSIVVCCVLLLL
CTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQG
IPFLEYKQFVTRTFFPKMCSDYEKSLVQPVYENDALGPRALPETHPLLQDWQATNTTRPN
IEEGITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKD
LLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQI
NKGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTICQVKE
KIIEAFYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQIP
EGASLAMSMQDKKENTLGRVKDLDTEKYVHLVLPHDELMENKRSHRQSHRKKVLPEIYLT
RLLSTKGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTN
SLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYA
KEIPEYKKRVQCYYQQIQDMPPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYR
NQVVNALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_004546186.1.88231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]