SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004578917.1.84141 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004578917.1.84141
Domain Number 1 Region: 220-397
Classification Level Classification E-value
Superfamily MIR domain 1.4e-50
Family MIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1084-1197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-18
Family SPRY domain 0.031
Further Details:      
 
Domain Number 3 Region: 4010-4088
Classification Level Classification E-value
Superfamily EF-hand 0.00000000112
Family Calmodulin-like 0.043
Further Details:      
 
Domain Number 4 Region: 662-810
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000673
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 104-185
Classification Level Classification E-value
Superfamily MIR domain 0.00000327
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 435-551
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000575
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2150-2215
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000981
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004578917.1.84141
Sequence length 4969
Comment PREDICTED: ryanodine receptor 2 [Ochotona princeps]; AA=GCF_000292845.1; RF=representative genome; TAX=9978; STAX=9978; NAME=Ochotona princeps; AL=Scaffold; RT=Major
Sequence
MLYLKMDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLE
QSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAILLRHSYSGMYL
CCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSER
YLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTVPSG
EHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLME
DKNLLLMDKEKADVKSTAFIFRSSKEKLDVGVRKEIDGMGTSEIKYGDSICYIQHVDTGL
WLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFNRFI
RGLDALSKKVKASSVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQ
EEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQ
FSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKV
LDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQY
KKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGL
HLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFP
VVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQERSYTRDL
LGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDD
NKRQHPCLVEFCKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEEKVKKMKLPKNY
QLTSGYKPAPMDLSFIKLTASQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNP
RLVPYALLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSGTGERFRIFRA
EKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGFKAQRWHQGNE
HYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDIGDGFIPVCSLGVA
QVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEV
TRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFSKTVPGGLPGAGLFGP
KNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKDATKPEFNNHKDYAQEKPSRLKQRFLL
RRTKPDCSTSHSARLTEDVLADDRDDYDFLMQTSTYYYSVRIFPGQEPANVWVGWITSDF
HQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNNGLEIGCV
VDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGL
FKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSL
HIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIE
NKYMPGLLRTGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKKHGLPG
IGLSTSLRPRMQFSSPSFVSINNECYQYSPEFPLDILKAKTIQMLTEAVKEGSLHARDPV
GGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKDAATPEEEGDAPEEESSV
EDSKLEGTGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSD
DFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECPCPE
EIRDQLLDFHEDLMTHCGIELDEDGSLDGNNDLTIRGRLLSLVEKVTYLKKKQTEKPVES
DSKKSSTLEQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGTGGLVRALPKTYTINA
VSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHET
VMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLA
SPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGW
NPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAVMEEA
IKIAEDPSRDGPSPTSGSSKTLDTEEDEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIH
AGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGFCPDHKAAMVL
FLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTR
CAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLR
RLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFD
ALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSVDSEGNFNPQPVDTSN
ITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEI
YRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSN
VTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTLTAKEKAKDREKAQ
DILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRSK
GEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCK
LGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGMESVKSALRAFLDNAAEDLEK
TMENLKQGQFTHTRNQPRGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSC
YRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNIYSIYNTKSSR
ERAALNLPTNVEDVCSNIPSLEKLMEEIVELAESGIRYNQMPHVMEVILPMLCSYMSRWW
EQGPESNPGRAGMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKV
KPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELLILDEFTTLARDLYAFY
PLLIRFVDYNRAKWLKEPTPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSF
LITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIA
LAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTESTTDPEKTVER
VLDIANVLFHLEQKSKFIGRRFYNLGSTVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAP
LYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPAEEDEVTKRVDPLHQL
ILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEVTGSQRSKEKEM
EKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAVLNGGNSTVQQKMLD
YLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDL
FRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVID
EQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLS
QDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDM
FLKLKDLTSSDTFKEYDPDGKGIISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLD
YEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIM
GSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFE
MQLAAQISESDLNERSANKEESEKERPEEQGPRMGFFSILTVRSALFALRYNILTLMRML
SLKSLKKQMKKMKKMTMKDMVTAFFSSYWSIFMTLLHFVTSVFRGFFRIVCSLLLGGSLV
EGAKKIKVAELLANMPDPTQDEVRGDGEEGERKPVESSLPSEDLTDLKELTEESDLLSDI
FGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPIPEVQEKLQEQKAKEEEKEEKEETKSEP
EKAEGEDGEKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKITAYQQKLLNYFARNF
YNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENAKVTASMDSSSDRIIAVH
YVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYIT
EQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALD
FSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSILGHYNNFF
FAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSED
GDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVIL
LAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANY
LFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences XP_004578917.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]