SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004596521.1.84141 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004596521.1.84141
Domain Number 1 Region: 224-479
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.06e-62
Family Eukaryotic proteases 0.000000187
Further Details:      
 
Domain Number 2 Region: 42-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-21
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 3 Region: 183-232
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000135
Family Complement control module/SCR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004596521.1.84141
Sequence length 483
Comment PREDICTED: complement C1r subcomponent-like protein [Ochotona princeps]; AA=GCF_000292845.1; RF=representative genome; TAX=9978; STAX=9978; NAME=Ochotona princeps; AL=Scaffold; RT=Major
Sequence
MKTKSTRSSQMSSSGELVREWCLFLWGVLQACATQGFVLLAQQQPQRFASPGYPGPYLKG
QESTLDIEAPEGLAVGLIFQDFDLETSPNCEGDAVTISAGGKEMCRLCGQLNSAQGSFPA
QREFVSPGRRLQLSFHTRGSCKDQGAHPHKGFLALYQAVAMNADLPSSRASRDPETVNAS
VDSSSRIQSHCREPYYQAVFPGTATCAASGAWKDQQEREEVPHCVPVCGRPVTPIIQDQT
TRGSSRAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIHPKDSVSARRKPRVDVYLG
HTDIEELLKLGSYPVRRVVVHPDYHQAESHDFNGDIALLELQQRVELGPHLLPVCLPDNE
ALYEAGVQGYISGFGMEMGRLTTQLKYSRLPVAPREACEAWLREKGRMEVFSDNMICVGG
NVQRDSGCQGDSGSVYVVWDARAHRWVATGIVSWGVGCATGYGFYTKVLSYVEWIKAVMG
STE
Download sequence
Identical sequences XP_004596521.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]