SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004613189.1.94378 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004613189.1.94378
Domain Number 1 Region: 527-746
Classification Level Classification E-value
Superfamily Bet v1-like 3.16e-40
Family STAR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 102-246
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004613189.1.94378
Sequence length 755
Comment PREDICTED: collagen type IV alpha-3-binding protein [Sorex araneus]; AA=GCF_000181275.1; RF=representative genome; TAX=42254; STAX=42254; NAME=Sorex araneus; AL=Scaffold; RT=Major
Sequence
MQHGDFPLPPAPSSAPPTFLPGVTREVPSGPSPGGGAGRSAGVPATAAADGGQGRLTSPL
VLLPRSARCQARRRRRQQQQQQQLCDWLPGGPARARVLSRLSSAPSPRGPGATSGAAQGA
GAALLLGGRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKN
NTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWI
DAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRD
ILCRQVDTLQKFFDACADVVSKDELQRDKVVEDDEDDFPTTRSDGEFLHNTNGNKEKLFP
HITPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRMDKESEKRRRAEE
AYKNAMIELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQTQNEKVRLHW
PTSMPSGDTFSAVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSL
QDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRN
DWETTIENFHVVETLADNAIIVYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVC
NFSVDHDSAPLNNRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWA
PASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_004613189.1.94378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]