SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004626834.1.9945 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004626834.1.9945
Domain Number 1 Region: 243-437
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-30
Family Laminin G-like module 0.065
Further Details:      
 
Domain Number 2 Region: 1520-1594
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000195
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 687-766,796-814
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000134
Family Zinc protease 0.085
Further Details:      
 
Domain Number 4 Region: 1586-1643
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000181
Family Complement control module/SCR domain 0.0055
Further Details:      
 
Domain Number 5 Region: 1464-1530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000945
Family Complement control module/SCR domain 0.0047
Further Details:      
 
Domain Number 6 Region: 538-634,719-766
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000126
Family Zinc protease 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004626834.1.9945
Sequence length 1787
Comment PREDICTED: pappalysin-2 [Octodon degus]; AA=GCF_000260255.1; RF=representative genome; TAX=10160; STAX=10160; NAME=Octodon degus; AL=Scaffold; RT=Major
Sequence
MCLKLLQLSLVILTGWVLHTTNSERGWTGKRSVVQRGPLKQVLLEGDRCWLGAKVQRPRA
APQHHPLGVYPRSPGNYLRPSPVRVQGAHHSGQGTPNAEGKAASRVSQDLTANTAGVGRE
IEQPAAPWAEDGPIGQSELLEEDDTYLGNLGSKELLGEAALQEHSARVTINTSADPKEPA
AESQGKGWARARHPRRVVKRQAEDVPGDPSTSVWPFPHWPKDPRLPQRVPSSPLEDSIQD
GGGGPAWKPKTFNPQRGLPVLYFSGRRERLRLRPELLADIPREAFTVEAWVRPEGGQNNP
AIIAGVFDNCSHTVNDKGWALGIRSGKDKGRQDARFFFSLRTDRMKKATTVTGHSRYQPG
MWTHVAATYDGQRMALYVDGTQVASSLGQSGPLHSPFMASCRALLLGGDSSENGHCFRGH
LGTLVFWSTALSQSHLQHSPKNASRAEGLATLVLTASFDPLKEQWTLFRDEQYPRLEVLQ
GSGPKPEIVSPLQPPLCGQTVCDNVELISHYNGHWPLREEKVIQYQVVNVCDDEGLHPTV
SEAQVWQQHEALNQAFSRYNISWQLSVHRVLNSTLRHRAVLVNCEPSKIGNDHCDPECEH
PLTGYDGGDCRLQGRCYAWNLGDGICHAACNNMLNDFDEGDCCDPEVTDVRKTCFDPDSP
KRAYMSVKELKEVLQLNGTHFLNVYFATSVRENLAGAATWPWEKEAVTHLGGVVLNPAFY
GMPGHTNIMIHEVGHVLGLYHVFKGVSERDSCDDPCRETVPSMETGDLCADTAPTPKSKL
CQIPEPANDACGLTHFPGAPFNNYMSYTDDNCTNSFTPNQVARMHCYLDLVYQQWSQSRK
PTPIPIPPMVIGQTPKSLTIYWLPPISGVVYDRAPGSMCGSCSEDGTFRQYVHSASSRRV
CDSSGYWTPEEAVGPPDVNQPCEPSLEAWSPELHLYHMNMTVPCPAEGCSLELLFQYPVQ
ADTLTLWVTYLSMDSSQALFDTEILLENQESVHLGPLDTFCDTPLTIKLHVDGKVSGVKV
YTFDERMEIDAALLTSQPHSPLCSGCKPVRYQVLREPPFASGSPMVVPQPQRKFTDMEVT
PGQMYQYQVQAKVGLELGEPSPPLHHIHGAPYCGDGKVEKSLGEECDDGDLLDTDGCSRA
CKLEDGFNCVGEPSLCYRYQGDGICEPFEEETSIADCGLYTPEGYSDQWATQAYSSHEDK
KKCPVSLVTGEPHSMICTSYHPDLPKLHPFAGWFPCVTSGKRPQDEVSEQAEGSLDKEDE
VWLQVCFNRPGVATAVFIFLTSDGLAPGKHQRPTVTLYLIDVSGSNHSLGTYELSCQHNP
LVINVTSASVLTHHTTSVLLNFSSHLVGISAVALRTSSHVSPSAPSNCISEAEGQKHREQ
SCVHQHCGKPASCVPLLLDNTDMVNCTSDSPGHMKCAITCNRGFALQTRSGQYLSPIQEH
LLTCAAGLWDQDVSCVPLDCGIPDPSLVNYANFSCSDGTGFLKRCSISCVPPAKLQGLSP
WLTCLEDGMWSLPEVYCKVECDAPPIIPNAKLLLPHCVQGSHDVGTTCKYECRPGYYVVE
RTGRQVRNKFLKIQCLEDGTWEQGNCMPVQCEPPPPVFEGMYECTNGFNLDSRCVLNCNQ
ESEKLPIVCTKEGQWTPEFRLCENLQGECSPPPSELNLLEYKCEQGYGIGAMCSPSCIIP
PNDPVLLPENVTADKLEYWMEPVKVQGIVCTGRRQWHPDPLLIQCIQACEPFQADGWCDT
INNRAYCNYDGGDCCSSTLSSKKVTPFAADCDQDECTCLDPKAEENQ
Download sequence
Identical sequences XP_004626834.1.9945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]