SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004645202.1.9945 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004645202.1.9945
Domain Number 1 Region: 93-518
Classification Level Classification E-value
Superfamily Sema domain 1.44e-101
Family Sema domain 0.00023
Further Details:      
 
Domain Number 2 Region: 1423-1549,1744-1895
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-40
Family p120GAP domain-like 0.039
Further Details:      
 
Domain Number 3 Region: 977-1066
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000293
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 885-980
Classification Level Classification E-value
Superfamily E set domains 0.000000000000204
Family Other IPT/TIG domains 0.035
Further Details:      
 
Domain Number 5 Region: 521-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000654
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1065-1109,1147-1200
Classification Level Classification E-value
Superfamily E set domains 0.00000012
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004645202.1.9945
Sequence length 1963
Comment PREDICTED: plexin-B3 [Octodon degus]; AA=GCF_000260255.1; RF=representative genome; TAX=10160; STAX=10160; NAME=Octodon degus; AL=Scaffold; RT=Major
Sequence
MAGPGQPPPQQTLLQISRVQRKCLVLPGCVPAIRLRAFLELAGGPSGSGQLLAGSWLSLA
PVMAPFGFHLLLPPWLLLLLSPQPLLPFLGTHHFSAPNTTFNHLALAPGQGTLYVGAVNR
LFQLSPELQLEVTAVTGPIVDSPDCVPFRDPAECPQAQLTDNANQLLLVSGRAQELVACG
QVRQGVCEKRRLGDVATVLYQAEDPGDGQFVAANTPGVATVGLVVPLPDQDLLLVARGLA
GKLSAGVPPLSVRQLTGPQPFSSEGLGRLVVGDFSDYNNSYVAAFANAHFAYFVFRRRGA
RAQAEYRSYVARVCLGDTNLYSYVEVPLVCQGQGLIQAAFLAPGTLLGAFAAGLSGARTA
LCAFPLAELDGSMEQARRLCYTAGGRGPIGTEEATVEYGVTSRCVTLPLDSPESYPCGDE
HTPSPIAGRQPLEARPLLQLRQPVSAVAALQADGHTIAFLGDIQGQLHKVFVNDSRGQVY
HSQQVGPPGMAISPDLLVDSSGSHLYVLTAQQVARVPVAACPQFLDCPSCLQARDPLCGW
CILQGRCTRKGQCERVTQAHQWLWSYEEGSRCLRIQSLRPAQQPRQEQGQVILSVPWLPT
LAEDEYFHCAFGDYDSLAHVQGPHVACITPPQDQVPHNPPGTDHVTLPLALMFEDVAVAT
TNFSFYDCTTVQALEVAAPCQACVGSPWRCHWCPQSGRCVHGEHCPEGERTVYSSQEEDI
RVRGPETCPQVEALAGPHLVPVGWDIHLALHVRNLQYFQGLPASYNCWLELPGELQRLPA
SLQETAGDRDKDEGAGLIHCQAQKFHPSTSQWELPVPIYVTRGETQRLDNARTLHVTLYD
CAVGHPDCSHCQAANGSLGCLWCGDSQPGCRYGPLCPPASVQLLCPTPSIKAIEPLTGPP
EGGLALTILGSNLGRTFADVQDAVSVAGVPCSPDPARYRTSARIVCVTSPAPNGTTGPVQ
VAIRSRPPGISAQHFTYQDPVLLSLSPRWGPQAGGTQLTIHGQHLHTGGNISAFVGGQAC
PILKPMCPEAIVCRTMPQALPGEATVLVVFGHAERKLLTSSFRYTANPRLLAAEPSVSFR
GGGRLIRVKGTDLDAVWQPLLSVWLEDEALRDPEVKALGDLDHSRSCGALTTDPQACVQL
AGGLVQCSTVCSVNSSRLLLCRSPAVPDRAHIKRVFFALDNVHVDFASASGGQDFQYQPN
PRLTPLSREGPSRPYRLKPGHVLHVEGEGLNLGISKEEVRVHIGDGACLVKTLTLTHLYC
EPPPHAPQAANGSSALPQFMVQMGNVRLALGPVQYEEEPVLPAFPVEAQVGLGMGAAVLI
AAVLLLTLMYRHKSKQALRDYQKVLIQLENLETGVGDQCRKEFTDLMTEMTDLSSDLEAS
GIPFLDYRTYAERTFFPGHGGCPLQPKLEGPGEEGRRATVRQGLTQLSNLLNSKLFLLTL
IHTLEEQPSFSQRDRCHVASLLSLALHSKLEYLTDIMKTLLSDLAAHYVRKNPKLMLRRT
ETMVEKLLTNWLSICLYTFLREVAGEPLYMLFRAIQYQVDKGPVDAVTGKAKRTLNDSHL
LREDVEFRPLTLMVLVGPAAGGATSGGELQRVPARVLDTDTITQVKEKVLDQVYKGTPFS
QRPSVYALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGLIPQLHN
GATVSQSLAQSCTSGENIPMLEDGEEGGVHLWHLVKATEEPEGVKARRGSLRERERARAK
AIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPVPLAIKYLFDFLDELAEKHGIEDPET
LHIWKTNSLLLRFWVNTLKNPQLIFDVHVSDNVDAILAVIAQTFIDACTISEHKVGRDSP
VNKLLYAREIPRYKQMVEKYYADIHRSSPASYQEMNSALAELSGNYTSAPHCLEALQELY
NHIHRYYDQIISALEEDPMGQKMQLACRLQHVAALVENKVTDL
Download sequence
Identical sequences XP_004645202.1.9945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]