SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004662223.1.11716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004662223.1.11716
Domain Number 1 Region: 216-393
Classification Level Classification E-value
Superfamily MIR domain 9.59e-51
Family MIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1080-1193
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-17
Family SPRY domain 0.026
Further Details:      
 
Domain Number 3 Region: 4005-4083
Classification Level Classification E-value
Superfamily EF-hand 0.000000000778
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 658-792
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000034
Family SPRY domain 0.058
Further Details:      
 
Domain Number 5 Region: 100-181
Classification Level Classification E-value
Superfamily MIR domain 0.00000327
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 420-547
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000183
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2145-2210
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000994
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004662223.1.11716
Sequence length 4964
Comment PREDICTED: ryanodine receptor 2 [Jaculus jaculus]; AA=GCF_000280705.1; RF=representative genome; TAX=51337; STAX=51337; NAME=Jaculus jaculus; AL=Scaffold; RT=Major
Sequence
MKEDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLEQSLS
VRALQEMLANTMEKSEGQVDVEKWKCMMKTAQGGGHRTLLYGHAILLRHSYSGMYLCCLS
TSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHL
SYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTVPSGEHGE
EQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLLEDKSL
LLMDKEKADVKSTAFAFRSSKEKLDVGMRKEVDGMGTSEIKYGDSVCYIQHVDTGLWLTY
QSVDVKSVRMGSIQRKAIMHHEGHMDDGINLSRSQHEESRTARVIRSTVFLFNRFIRGLD
ALSKKTKGPTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGM
INLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFSGS
LDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVL
CSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWY
YELMVDHTQPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWS
GCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSF
SAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQERTYTRDLLGPT
VSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQ
HPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEEKVKKMKLPKNYQLTS
GYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVP
YTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSGTGERFRIFRAEKTY
AVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDLELGSDDRAFAFDGFKAQRWHQGNEHYGR
SWQAGDVVGCMVDMSEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGR
MNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRID
GTIDSSPCLKVTQKSFGSQNSSTDIMFYRLSMPIECAEVFSKTMAGGLSGAGLFGPKNDL
EDYDVDSDFEVLMKTAHGHLVPDRIDKDKETPKPEFNNHKDYAQEKPSRLKQRFLLRRTK
PDYSTSHSARLTEDVLADDRDDYDYLMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYD
TGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNNGLEIGCVVDAA
SGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSE
HKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPE
ENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYM
PGLLRTGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDEKKKHGLPGIGLS
TSLRPRMQFSSPSFVSISNECYQYSPEFPLDILKAKTIQMLTEAVKEGSLHARDPVGGTT
EFLFVPLIKLFYTLLIMGVFHNGDLKHILQLIEPSVFKEAATPEEEGDDLEKELSVGESK
LEAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAK
LQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKNECPCPEEIRDH
LLDFHEDLMAHCGIELDEDGSLDGSSDLTIRGRLLSLVEKVTYLKKKQVEKPISSTATKP
STLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGISVED
TINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVM
VNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMR
GSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEG
ERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPSLRGEGGNGLLAAMEEAIKIAE
DPSRDGPSPASGSSKTLDTEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGE
AIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVLEPDMSAGFCPDHKAAMVLFLDRV
YGIEVQEFLLHLLEVGFLPDLRAAASLDTVALSATDMALALNRYLCTAVLPLLTRCAPLF
AGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFD
VPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQK
KYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDTSNITIPE
KLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEIYRWPI
KESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSR
DLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKF
LQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRSKGEHFP
YEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASSKEKEMVTSLFCKLGVLV
RHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLDSVKSALRAFLDNAAEDLEKTKENL
KQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILT
SLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNIYSIYNTKSARERAAL
NLPVNVEDVCPNIPSLEKLMDEIVELAESGIRYTQMPHVMEVVLPMLCSYMSRWWEHGPE
NHPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKSQLL
KTHFLPLMEKLKKKVAMVVSEEDHLKAEARGDMSEAELLILDEFTTLARDLYAFYPLLIR
FVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITDT
KSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPVGLNICAPGDQELIALAKNR
FSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTEDTSDPEKTVERVLDIA
NVLFHLEQKSKCAGRGYFSLGSKVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLP
RHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEATKRVDPLHQLILLFS
RTALTEKCKLEEDYLYMAYADIMAKSCHDEEDDDGEEEVKSFEVTGSQRSKEKEMEKQKL
LYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLREK
KDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQ
LLCEGHSSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQR
NFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQ
IELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLK
DLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFV
KRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKR
IERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAA
QISESDLNERSANKEENEKEGLEEQGPRMGFFSLLTVQSALFALRYNVLTLVRMLSLKSL
KKQMKRVKKMTMKDMVTAFFLSYWSVFMTLLHFVASVCRGFFRIVCNLLLGGSLVEGAKK
IKVAELLANMPDPTQDEVRGDGEEGERKSLETTLPTEDLADLKELTEESDLLSDIFGLDL
KREGGQYRLIPHNPNAGLSDLMTNPVPIPEVQEKLQEQKVKEEEKEEKEETKSEPEKAEG
EDGEKEEKAKEDKSKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRM
LALFVAFAINFILLFYKVSTSSVVEGKELPPRSSSENVQVTTSLDSNSQRIIAVHYVLEE
SSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSE
DDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAR
EKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHL
LDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPD
MKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQ
GLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLM
YLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences XP_004662223.1.11716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]