SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004674257.1.23501 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004674257.1.23501
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily E set domains 1.68e-56
Family RhoGDI-like 0.0000000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004674257.1.23501
Sequence length 150
Comment PREDICTED: retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta [Condylura cristata]; AA=GCF_000260355.1; RF=representative genome; TAX=143302; STAX=143302; NAME=Condylura cristata; AL=Scaffold; RT=Major
Sequence
MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSIPGVEHEARVPKKILKCKAVS
RELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSRVRLFYV
Download sequence
Identical sequences F7AAZ5
9796.ENSECAP00000016113 ENSECAP00000016113 ENSECAP00000016113 XP_003365184.2.31192 XP_004674257.1.23501 XP_014718000.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]