SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004685271.1.23501 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004685271.1.23501
Domain Number 1 Region: 287-383
Classification Level Classification E-value
Superfamily Immunoglobulin 6.57e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 405-737
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 3.92e-16
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 34-85
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000457
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 208-299
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000108
Family I set domains 0.089
Further Details:      
 
Domain Number 5 Region: 132-204
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000401
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004685271.1.23501
Sequence length 799
Comment PREDICTED: follistatin-related protein 5 [Condylura cristata]; AA=GCF_000260355.1; RF=representative genome; TAX=143302; STAX=143302; NAME=Condylura cristata; AL=Scaffold; RT=Major
Sequence
MHRLCWFLIQDGPFGSCENKYCGLGRHCVISRGTGQAECVCMDHCKPHYKPVCGSDGEFY
ENHCEVHRAACLKKQKITIVHNEDCFFKGDNCEATEYSKMKNMLLDLQNQKYITQENENP
NGDDLSRKKLLVDQMFKYFDADNNGLIDINELTQVIKQEELSKDLSECTLYDLLKYDDFN
ADKHLALEEFYRAFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGSLRPPIIWKRNNII
LNNLDLEDINDFGDDGSLYITKVTTTHMGNYTCYADGYEQVFQTHIFQVNVPPVIRVYPE
SQAREPGVTASLRCHAEGIPNPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDT
GAYTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPI
ECEFQRHIKPSEKLLGFQDEVCPKAEEDEVQRCVWASAVNVKDKFIYVAQPTLNRVLIVD
VQSQKVIQAVSTDPVPVKLHYDKSHDQVWVLSWGTMEKTSPTLQVITLATGNVPHHTIHT
QPVGKQFDRVDDFFIPATTLIITHMRFGFILHKDEAALQKIDLETMSYIKTINLKDYKCV
PQSLAYTHLGGYYFIGCQPDSTGAGPLQLMVDSVTDSVLGFNSDVTGTPYVSPDGHYLVS
VNDVKGLVRVQYITIRGEIQEAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLF
VELASGKVKMIKSLKEPLNAEEWPWNRKNRQIQGSGLFGQYLMTPSKDSLFILDGRLNKL
NCEITEVEKGNTVIWVGDA
Download sequence
Identical sequences XP_004685271.1.23501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]