SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_004703729.1.18182 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004703729.1.18182
Domain Number 1 Region: 494-713
Classification Level Classification E-value
Superfamily Bet v1-like 2.89e-40
Family STAR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 84-244
Classification Level Classification E-value
Superfamily PH domain-like 8.48e-28
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004703729.1.18182
Sequence length 722
Comment PREDICTED: collagen type IV alpha-3-binding protein [Echinops telfairi]; AA=GCF_000313985.1; RF=representative genome; TAX=9371; STAX=9371; NAME=Echinops telfairi; AL=Scaffold; RT=Major
Sequence
MQHGYAPTHTSFFSTPPTSLPVVTRESGRGSSSGGNAGRNAGVTTTAAADGWKSRLPSPL
VLLPRSARCQARRRRRRGGHTSSSRLLPPAPERALFPSPSPDPSPRGLRAFPGAPQGAEA
ALLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNT
LSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDA
IEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDIL
CRQVDTLQKFFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKIFPHV
PPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRLDKEGPNSLINEEEF
FDAVEAALDRQDKIEEQSQSEKVRLHRPTVLPSGDAFSSVGTHRFVQKPYSRSSSMSSID
LVSASDDVHRFSSQVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLD
PLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIVYQTHKRVWPAS
QRDVLYLSAIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINIAMICQTLVSPP
EGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPI
LF
Download sequence
Identical sequences XP_004703729.1.18182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]