SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004704761.1.18182 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004704761.1.18182
Domain Number 1 Region: 135-272
Classification Level Classification E-value
Superfamily ISP domain 7.59e-39
Family Rieske iron-sulfur protein (ISP) 0.000000774
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 1.35e-23
Family ISP transmembrane anchor 0.0000325
Further Details:      
 
Domain Number 3 Region: 1-57
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 3.27e-20
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.0000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004704761.1.18182
Sequence length 274
Comment PREDICTED: cytochrome b-c1 complex subunit Rieske, mitochondrial [Echinops telfairi]; AA=GCF_000313985.1; RF=representative genome; TAX=9371; STAX=9371; NAME=Echinops telfairi; AL=Scaffold; RT=Major
Sequence
MLSVAARSGPFAPVLSATSRGVVGALRPLVQASVPATAEPPKLDLKRPFLCRESLSGQAA
GRPLVASVGLNVPASARYSHTDVKVPDFSDYRRAEVLGSTKSSKESSEARKGFSYLITAA
TTVAATYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
KKEIEQEAAVEMSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRRGPAPLNLEVPSYEFMSEDLVVVG
Download sequence
Identical sequences XP_004704761.1.18182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]