SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004712642.1.18182 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004712642.1.18182
Domain Number 1 Region: 668-816
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.75e-39
Family Toll/Interleukin receptor TIR domain 0.0000417
Further Details:      
 
Domain Number 2 Region: 399-634
Classification Level Classification E-value
Superfamily L domain-like 3.26e-38
Family Ngr ectodomain-like 0.059
Further Details:      
 
Domain Number 3 Region: 25-317
Classification Level Classification E-value
Superfamily L domain-like 2.53e-32
Family Ngr ectodomain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004712642.1.18182
Sequence length 840
Comment PREDICTED: toll-like receptor 4 [Echinops telfairi]; AA=GCF_000313985.1; RF=representative genome; TAX=9371; STAX=9371; NAME=Echinops telfairi; AL=Scaffold; RT=Major
Sequence
MISSSCLARTLIPAMAFLSCLRPESWDPCTEVVPNITYQCMEVNLYNIPENLPSSTENLD
LSFNFLRHLGSHNFSKFPELRVLDLSRCGIQVIEDDTYQGLNQLSTLILTGNPVQHLDLR
TFSGLSSLQKLVAVEINLNSLEDLPIGHLKTLKELNVAHNFIHSFKLPEYFCNLSNLEYM
DLSNNQIHNIYHKDLQVLYQIPFHNLSLDLSLNKIDFIEPGAFKDIKLQKLVLRSNFDSM
DVMKTCIQSLAGLEVYELVLGEFKNERQLNEFDKSALEGLCNLTIENFRIAFFDEFSLDD
IGVFHCLENVSAVSLLNLYVNHLERIPKEFRWQSLELIDCDLEQFPTLTLSSLKRFIFTA
NEVSNTFGELDLQSLEFLDLSKNGLSFRSCCSSRDFGTVRLKHLDLSFNEVISMSSNFVD
MEQLEHLDFQYSTLKRANAFSVFLSLTKLRYLDLSYTNTHVTFDGFFHGLFSLEVLKMPG
NSFQGNSLPNILTNLGNLTFLDLSNCQLETIDPTALNPLGKLQVLNMSYNKLLSLDLFPY
ENLSSLQVVDVSFNRIVTLQIQERYHLPNKLTLLNVTQNDFACACEHQTSLQWIKDQRQL
LVDVEQMLCATPAGMKGLPVLSFRNTTCQMSKTIISVSVLMVIMVSLVVVLVYKFYFHLM
LLAGCKRYGRGECTYDAFVIYSSHDEDWVRNELVKNLEEGVPPFRLCLHYRDFIPGVAIS
ANIIQEGFHKSRKVIVVVSKNFIQSRWCIFEYEIAQTWQFLSTCSGIIFVILQKVEKSLL
RQQVELYRLLNRNTYLEWEDNALGQHIFWRRLRKALLAGKPQNPEGTPDADMQPEATSAM
Download sequence
Identical sequences XP_004712642.1.18182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]