SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004737947.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004737947.1.14098
Domain Number 1 Region: 271-382
Classification Level Classification E-value
Superfamily PX domain 3.4e-29
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 4-74
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-16
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004737947.1.14098
Sequence length 624
Comment PREDICTED: sorting nexin-18 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MALRARALYDFRSENPGEISLREHEVLSLCSEQDIEGWLEGVNSRGDRGLFPASYVQVIR
APEPGPAGDGGPGAPARYANVPPGGFDPLPAAPPASFKPPPDAFQPLLQPQQAPPPSTFQ
PPAAGYPYGGGALQPSPQQLYGGGYQASQGSDDDWDDEWDDSSTVADEPGALGSSAYPDL
DGSSSAGGAASRYLLSTRSDLSLGSRGGSAPPQHHPSGAKSSATVSRNLNRFSTFVKSGG
EAFVLGEASGFVKDGDKLCVVLGPYGPEWQENPYPFQCTIDDPTKQTKFKGMKSYISYKL
VPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWM
NHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALD
LQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFEL
DQQAFSAGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQK
GALTKVKESRRHVEEGKMELQKADGIQDRCNTISFATLAEIHHFHQIRVRDFKSQMQHFL
QQQIIFFQKVTQKLEEALHKYDSV
Download sequence
Identical sequences M3YSA6
XP_004737947.1.14098 ENSMPUP00000014216 ENSMPUP00000014216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]