SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004738253.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004738253.1.14098
Domain Number 1 Region: 31-149
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-44
Family Dcp1 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004738253.1.14098
Sequence length 600
Comment PREDICTED: mRNA-decapping enzyme 1A [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAPSCPRLRLRRRGSAPEFKMESLSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCP
KANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNA
SLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEM
LSRAKDEYERNQMGDSNISSPGLQPSSQLSNLGSTETLEETPSGSQDKSAPSGHKHLTVE
ELFGTSLPKEQPVVVGLDSEEVERLPGDASQKETSSFLPFSFEQSGGAPQSENLGVHPAA
HHSVPPEVPTPVLITPASITQSGDKQTPGYAIPLRPVLSPTLPAEAPTAQVPPSLPRNTT
MIQAVKTTPRQRSPLLSQPVPELSHANLTATQSPFRAPLSVTNTAGTSLPSVDLLQKLRL
TPQHDQIQTQSLGKGAVAPSFSPAAGQLATPESFIEPPSKTAAARASASLSNMVLAPLQS
MQQNQDPEVFAQPKVLPSAIPVTGPTLVTATTMAVSSVLLSPSVFQQTVTRSADLERKAN
APSPLTVGTSENQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
Download sequence
Identical sequences M3YZF2
XP_004738253.1.14098 ENSMPUP00000016712 ENSMPUP00000016712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]