SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004738671.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004738671.1.14098
Domain Number 1 Region: 509-699
Classification Level Classification E-value
Superfamily Sec7 domain 6.93e-66
Family Sec7 domain 0.00000455
Further Details:      
 
Domain Number 2 Region: 731-855
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000226
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004738671.1.14098
Sequence length 1121
Comment PREDICTED: IQ motif and SEC7 domain-containing protein 1 isoform X8 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MACRRRYFVEGEAPSSETGTSLDSPSAYHQGSLAPASSLSPDRYEHASVGAYGLYSGPPG
QQQRTRRPKLQHSTSILRKQAEEEAIKRSRSLSESYELSSDLQDKQVEMLERKYGGRLVT
RHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFSFEGPEKVHSSYFEG
KQVSVTDDGSQLGALVPSECGDLGEPPTLKSPAPSSDFADAITELEDAFSRQVKSLAESI
DDALNCRSLHAEEAPAPDAGRTRDAEPKPALHSVDHHKLDEMTASYSDVTLYIDEEELSP
PLPLSQAGHRPPSMESDLRLRAGGAAQDYWALAHKDDKGDTDTSCRSTPSLERPEQRLRV
EHLPLLTIEPPSDSSVDLSDRSDRGSLKRQSAYERSLGGPQGSPKHGPLGGPPKSLPREE
PELRSRPPRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNSNDTINCSSESSSRDS
LREQTLSKQTYHKETRNSWDSPAFSNDVIRKRHYRIGLNLFNKKPEKGVQYLIERGFVPD
TPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAMELDEALRKFQAH
IRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPE
RKMKLEDFVKNLRGVDDGEDIPREMLIGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKP
IGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKK
KNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLINFNAPNPQDRKKFT
DDLRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNGTLSRACLDDSYASG
EGLKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEGSIISSPHMRRRPTSTRECPSRPHQ
TMPNSSSLLGSLFGSKRGKPPPQAHPPSAPPQPPPHPPGLPHPPHTVVASHHQGPVEGPP
PASVHGHHSQYCHMQQNPPPYHHHHHYHPPQHIQHAHQYHHGPHGGHPPYGAHVHSHPPL
PSAHAGHPGHPGHAVHHHGQPPAPPPPTSSKAKPSGISTIV
Download sequence
Identical sequences M3Z0R3
ENSMPUP00000017175 XP_004738671.1.14098 ENSMPUP00000017175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]