SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004739026.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004739026.1.14098
Domain Number 1 Region: 476-671
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.16e-61
Family Nucleotide and nucleoside kinases 0.00013
Further Details:      
 
Domain Number 2 Region: 322-462
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-29
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 119-177
Classification Level Classification E-value
Superfamily L27 domain 4.3e-23
Family L27 domain 0.0000385
Further Details:      
 
Domain Number 4 Region: 253-337
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-19
Family PDZ domain 0.000032
Further Details:      
 
Domain Number 5 Region: 184-235
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000871
Family L27 domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004739026.1.14098
Sequence length 675
Comment PREDICTED: MAGUK p55 subfamily member 5 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MTTSHMNGHVTEESDSEVKNVDLASPEEPQKHREMAVDCPGDLGARMMPVRRSAQLERIR
QQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPIFDTEEGIVLESPHYAVK
ILEVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAVTVHMNKASPPF
PLISNAQDLAQEVQTVLKAVHQKEGQELTALLSAPHIQALLLAHDKVAEQEMQLEPFTDE
RVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDHEVAGRDYHFVSRQAFEADI
AAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKALRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLIN
KLDTEPQWVPSTWLR
Download sequence
Identical sequences M3Y6I5
XP_004739026.1.14098 XP_004739027.1.14098 ENSMPUP00000006936 ENSMPUP00000006936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]