SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004739042.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004739042.1.14098
Domain Number 1 Region: 469-533,575-673
Classification Level Classification E-value
Superfamily PH domain-like 6.42e-31
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 2 Region: 681-805
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1093-1225
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-18
Family Second domain of FERM 0.0071
Further Details:      
 
Domain Number 4 Region: 994-1071
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000827
Family Ubiquitin-related 0.049
Further Details:      
 
Weak hits

Sequence:  XP_004739042.1.14098
Domain Number - Region: 19-127,580-600
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00136
Family BAR domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004739042.1.14098
Sequence length 1364
Comment PREDICTED: pleckstrin homology domain-containing family H member 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAELKVETRASVDWQKRCLALETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENA
ETQVGVMEEKVKLSNLKNVDAGSLHRKYQDLLKAMRGKDELISQLEAQLEKQKQMRAEEA
KVVQEKAAKIKEWVTLKLGELEMENQHLKSSNEHLAEQVGALQDALEALQMAPSGKLLVA
PQETPEQDSDASGPGVQPIGQDSGPQAKDALKAALPAPSPGALPRRDSGPKAGISLEDSS
SIVVHPGEIAEAKTLPPHLGREGSPRQLCMKPRTHRHGSASWGEGLVTAQGGTLPGTKNS
AREGSPGCSLTLPKARVPSTPRDSIQLAKRHHSQPQVGPGCFNHVVSIEIGNLSALHPSR
LPEVEARAELREEPENMEMGEPPPGGKKEERESPQAPGAELEEVDLGNTPPTPPLHRFPS
WESRIYAVAMAGMRLSDASPRMNATCCASSPPALAFPGPFSGLVYKNVTVPVYTALKGRA
TQISTVPFVDESSGSDDDCCSQASFRTSVPCSESRKTSGLGSPRAIKRGVSMSSLSSEGD
YAIPPDAYSLDSDYSEPEHKLQRTSSYSAEGPGLAGESLEKSGYLLKMGSRVKTWKRRWF
VLRQGQIMYYKSPSDVIRKPQGQVELNSRCQIVRGEGAQTFQLISEKKTYYLTADSPGLL
EEWIRALQSLLKVQAVGPPALPRGGSKPTVKGWLTKVKHGHSKLVWCALVGRTFYYYRSH
EDKRPLGHLPVRDARIEEVDRSCDSDEDYEAGGSRRLLSSHCTLVIHPPEHSPTYLLIGT
KHEKDTWLYHLTVAAGGSSATVGTAYEQLIGKLMDGEGDPDSPLWRHPILCYSKDGLYTS
LTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLAHPELQSEIYCQ
LMKQTSGRPPQKCSLIQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRNETGQYATYC
QRAVERTLQTGEREARPSRMEVVSILLRNPFHHSSPFSIPVHFTNGTYQVVGFDGSSTVD
EFLQRLNQETGMRKSSHSGFALFTDDPSGRDLEHCLHGSIKICDAISKWEQAVKELHSGK
AEGGTRVVKLMYKNRLYFRSQVKGETERERLLLASQTSGEIVAGRFPVNKELALEMAALM
AQVEYGDLERPSPPGPGSPPPAKVQHHLQQVLDRFYPRRYRHGAPPEQLRHLADLLTTKW
AALQGCSPPECIRIYLTVARKWPFFGAKLFAAQPAQMFSKDSSLVWIAVNEDGVSILDYS
TMQVHVTYPYSSVMTFGGCRDDFMLVIRSIPDQSSGKGHIEKLLFRMAAPKIAEATFIMA
SYMNHCSATVNPRNNPPAAHRLWELDGQQFFASVPCAARGPTLL
Download sequence
Identical sequences M3Y6S6
ENSMPUP00000007027 XP_004739042.1.14098 ENSMPUP00000007027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]