SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004739401.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004739401.1.14098
Domain Number 1 Region: 16-221
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.07e-61
Family BAR domain 0.00000833
Further Details:      
 
Domain Number 2 Region: 598-675
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000016
Family SH3-domain 0.000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004739401.1.14098
Sequence length 676
Comment PREDICTED: amphiphysin isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MNILPYWANRTSQVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGM
QEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQFPD
IKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEE
LPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHADKAFTIQGAPS
DSGPLRIAKTPSPPEEASPIPSPTASPNHTLAPASPAPARPRSPSQTRKGPPVPPLPKVT
PTKELQQENIISFFEDNFVPEISVTTPSQNEVPEVKKEETLLDLDFDPFKPEVAPPGSAG
VTHSPMSQTLPWDLWTTSTDLVQPASGSTFNGFTQPQDTSLFTMQTDQSMICNLAESEQA
PPTEPKAEEPPVVAAPAVGLDSGLDTQAEEPVEGAVVIPGTDATVTPGAVVLAAEEAPVE
ETEMEKAALPAGEGAGVEETRTDADTMEAIDRDISQPEEPEAAAPQEKVIPSVVIEPASN
NEGEGDHEVPTGAESMETPGAPALPGPASEPPELAAEPRASEDSQPLPSTPAASEASQDV
PPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDL
ATYKGLFPENFTRRLD
Download sequence
Identical sequences M3Z355
XP_004739401.1.14098 ENSMPUP00000018017 ENSMPUP00000018017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]