SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004739442.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004739442.1.14098
Domain Number 1 Region: 495-608
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-31
Family SH2 domain 0.000000711
Further Details:      
 
Domain Number 2 Region: 180-273
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.35e-28
Family Ras-binding domain, RBD 0.00026
Further Details:      
 
Domain Number 3 Region: 300-420
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000142
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004739442.1.14098
Sequence length 611
Comment PREDICTED: growth factor receptor-bound protein 10 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MALAGCPDSFLHRPYYQDQVEQTPPLSPRDLAGPGFPAPSDRDRLTNHQDTDHVTCHCLE
EVGGEEIPISHKEDDVDLEALVNDVNASLESLYPSCSMQSETAPLLQNGQHSRSQPPPSG
TRSLQTPRSQPMHILAVRRLQEEDQELRTSSLPAIPNPFPELCGPGSPPVLTRGSLPPSQ
AAAKQDVRIFSEDGTSRVVEIPADMTARDLCQLLVYRSHCVDDNSWTLVEHHPHLGLERC
LEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGGHNQLLQN
FLNSSSCPEIQGFLHVKELGRKSWRKLYVCLRRSGLYCSTKGASKEPRHLQLLGGLEESS
VFSLIAGKKQYSAPTDYGFCIKPNKVRNETKELRLLCAEDEQGRTCWMTACRLLKYGMLL
YQNFRIPPSRKALLPSFCTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWR
KRSTRMNIPGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQ
SNPKAFVLTLCHHQKIKNFQILPCEDDGQMFFSLDDGNTRFSDLIQLVDFYQLNKGVLPC
KLKHHCIRVAL
Download sequence
Identical sequences M3Z384
ENSMPUP00000018046 XP_004739442.1.14098 XP_012914923.1.14098 ENSMPUP00000018046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]