SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004739810.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004739810.1.14098
Domain Number 1 Region: 801-893
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.78e-21
Family Tudor domain 0.004
Further Details:      
 
Domain Number 2 Region: 518-611
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.06e-20
Family Tudor domain 0.006
Further Details:      
 
Domain Number 3 Region: 1547-1645
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-20
Family Tudor domain 0.0049
Further Details:      
 
Domain Number 4 Region: 1016-1110
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.08e-19
Family Tudor domain 0.0051
Further Details:      
 
Domain Number 5 Region: 1336-1429
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.43e-19
Family Tudor domain 0.0057
Further Details:      
 
Domain Number 6 Region: 278-384
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000752
Family Tudor domain 0.0078
Further Details:      
 
Domain Number 7 Region: 41-134
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000459
Family Tudor domain 0.013
Further Details:      
 
Domain Number 8 Region: 2014-2095
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000903
Family Tudor domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004739810.1.14098
Sequence length 2120
Comment PREDICTED: tudor domain-containing protein 6 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MCSTPGLPTPGASLVLRVSFVDVHPEVIPVQLWGLVGQRREEYLRLSREIQEAAATRGPW
ALGGASASPGELCLVQVGLLWHRCRVVSQQAQESRVFLLDEGRTITAGAGSLAPGRSEFF
HLPSEVLGCVLAGLVPAGGGGGGGGGGGEPQHWPSSAVDFLSSLQGKQVHGRVLDVLLLH
RLVLLEVPGLFQQMQELGLARQVPDSLFRSLLKRYLTAATAGLGSAAPILPRVPPKQEQP
GLDYFYPRLQLGVTEPVVVTQVCHPHRIHCQLRSLSQEIHRLSESMAQIYRGSTGAGDEN
STSATWEEKEESPDKPGSPCASCGLDGHWYRALLLETFRPQRCAQVLHVDYGRKELVSCS
SLRYLLPEYFRMPVVTYPCALYGLWDGGQGWSRSQVGDLKALILGQAVNAKIEFYCSFEH
VYYVTLYGEDGINLNCVFGVQSCCLADRFLQSQGMEEEEEEREIAFQSQSPAEEVDEEIS
LPALRSIRLKINAFYDAQVEFVRTPSQFWIRLRKHKGTFSKLMRRMCSFYSSASKLDGVV
LKPEPDDLCCVKWKENGYYRAMVTRLDDKSVDVFLVDRGSSENVDWYDVRMLLPQFRRLP
ILALRCTLADIWPLGESWSQEAISFFKKTVLHKELVIHVLDKLDNQYVIEILDESRTGEE
NISKVIAQAGFAKYQEFETKEKIPGNAYSPGHISSHFTSENNKICPAKKAEVEQKAKRDN
QTASVSEILSETAVITDIPVGLVVPEKENRVSVYSPLIRNFLEIKPGSSCKGELKVGSTV
EVKVSYVESPGYFWCQLTRNTQGFKTLMCNIQDYCKTTATSYGGTTPACLAKRTVNGKWS
RAVIRGVQSAEHVKVMFVDYGDKEMVSVKNIYSISEEFLKVKAQAFRCSLYNLIQPTGQN
PFAWDEKAIQAFSEFVDNAWEENLELKCTIFALASVQDEELFNVVDLLTPFQSACHFLVE
KRLARPVKLQKPLEPSVQLHSYYYSTHDMKIGSEESVYITHVDDPWTFYCQLGRNASILE
QLSCNITQLSKVLLNLQTTPLIPGTLCLAKYTDGNWYRGIIIEKEPNKVFFVDFGNICVV
TNDDLLPIPTDAYDVLLLPMQAVKCSLSDIPDHIPEEITAWFRETILDKSLKALVVAKDP
DGRLIIELYDDSIQINANINEKLGILGYKGRTRKKSVALLATTETLEIKKENMKLSPIQY
VSKSTENKFCSMEILGESYKSKISSACKDTKLLRSSTKANLVTQYQDSVGNQGNQVCPVT
PEKKEDSFAEPPLKAKKLEATPSERKIGESYNKDLPLKFSDFPQKIIMPGFKTAVYVSHI
NDFLDFYVQLTEDEAEITHLSERLNDARTKPQCYSGPPLQRGDVICAIFPEDNLWYRAVV
KEQQPNDLLSVQFIDYGNVSVVHTNKVRKLDLMNALLPGLGIHCSLRGLWVPEILKCKEM
MHYFSQRTDEAQIRCEFVKFQDRWEVILADEHGIIAEDMLSRYAFNEKSQVRLSDQIIKS
ACSKSVSKTDTDTSMFLNWYNPTMRMIRAYATVIDGPEYFWCQFADTEKLQYLEVEVQTA
GEQVTDWRSCVPCPHIGDPCIVRYREDGHYYRALITNICEDYLVSVRLVDFGNVEDCVDP
KALWNIPSELLVVPMQAFPCCLSGFNISEGVCPQEGNDYFYEIVTEDVLEITILEIKRDV
CNIPLAVVDLKSKGESINEKMKKYSKVGISSSDLSYEKKDPTKGTLGSLSPEVRLKKPSS
KAGQEKTPYVEPSTDELSEKVEKGLNILETKPTKLYDPDTDNIFEAFENSGKDKIGPEVL
EGKIQCHLVDKAKFDDKYLMAGFNTLLPQESQTKEMLEMNSLEVTLSPDDESKEFLELES
IELQHSLVGDEDKEELGLVPPIVPLSQGCDPEPILQPFTMQLSLSCDSEKQPELELPTAQ
LCLDDKINTLSLRVGQMAQEPTCAEDTREPSCVECFQDQHGSYMHLHAKDCHPNMQIETN
IYKEEFTEYHNRDAISSLTLFSEEESRAGRKHHNALQDHVSAQPEKTYTLKGFAVGSACV
VWSSLRNTWSKCEILEITEEGTRVMNISTGAEEIVNPENVWNGIPKLDKGPFEVLGFFFF
SLFLSLSLFLFFQKRGLEVI
Download sequence
Identical sequences M3YLZ3
ENSMPUP00000012350 XP_004739810.1.14098 ENSMPUP00000012350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]