SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004739991.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004739991.1.14098
Domain Number 1 Region: 228-297
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004739991.1.14098
Sequence length 478
Comment PREDICTED: transcription factor EB [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQALGGPPTPAISTPVHFQ
SPPPVPGEVLKVQSYLENPTSYHLQQSRDQKVREYLSETYGNKFAAHISPAQGSPKPLPA
ASPGVRAGHVMSSSAGNSAPNSPMAMLHIGSNPEREFDVIDNIMCLDDVLGFINPETQMP
NTLPLSSSRLNVYSGDPQVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNHN
LIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENH
SRRLEMTNKQLLLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEALL
LEAEVPDPEPLPVLPPQAPLPLPAQPPQPPSPFHHLDFSHSLSFGGGGDEGPPGYPEPLG
PEHGSPFPNLSKKDLDLMLLDDSLLPLASDPLFSTMSPEASKASSRRSSFSMEEGDVL
Download sequence
Identical sequences M3YQ82
ENSMPUP00000013491 ENSMPUP00000013491 XP_004739991.1.14098 XP_012917853.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]