SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004740085.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004740085.1.14098
Domain Number 1 Region: 91-314
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-57
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 325-476
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-29
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 461-527
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.55e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 554-648
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-20
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004740085.1.14098
Sequence length 663
Comment PREDICTED: FYVE, RhoGEF and PH domain-containing protein 2 isoform X8 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MEACRMEGESKEKLASVSSLVTVFENSRTPGAASRVCKLEIEHHCPGGRAPPPAEPWKEP
NLGETLQGSEPRMVSRRYLSSLKNKLSSGAWRKSCQPGTDPGLGTQEPEEKRIVQELLET
EKAYVARLHLLDQVFFQELLREARASKAFPEDVVRLIFSNISSIYQFHAQFFLPELQRRL
DDWTATPRIGDVIQKLAPFLKMYSEYVKNFERAAELLASWTDKSAPFQEVITRIQSSEAS
GSLTLQHHMLEPVQRIPRYELLLKEYVQKLPAQAPDRADAQKALDMIFLAAQHSNAAITE
MERLQDLWDVYQRLGLEDDIVDPSNTLLREGPVLKISFRRSDPMERYLFLFNNMLLYCIP
KVIQVGAQFQVRTRIDVAGMKVRELTDAEFPHSFLVSGKQRTLELQARSQEEMISWIQAC
QAAIDQIEKRNETFKAAVQGPEGDTQEQEQLQSEELGLRAPQWVRDKMVTMCMRCREPFN
ALMRRRHHCRACGYVVCAKCSDYRAELKYDGNRPNRVCFHCYTFLTGNVLREDKEDKKRG
ILEKGSTTGSEQSIMCGFLQLVGDKWGKSGPRGWCVIPRDDPLVLYVYAAPQDMRAHTSV
PLLGYQVTAGTQADSRVFQLQQSGQLYTFKAETEELRDRWVKAMERAASGWSPRGPSDGD
LSD
Download sequence
Identical sequences M3YRR4
ENSMPUP00000014024 XP_004740085.1.14098 ENSMPUP00000014024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]