SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004741281.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004741281.1.14098
Domain Number 1 Region: 590-891
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-83
Family Protein kinases, catalytic subunit 0.0000000000861
Further Details:      
 
Domain Number 2 Region: 1-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.96e-75
Family Ephrin receptor ligand binding domain 0.0000000149
Further Details:      
 
Domain Number 3 Region: 301-506
Classification Level Classification E-value
Superfamily Fibronectin type III 4.98e-41
Family Fibronectin type III 0.0000216
Further Details:      
 
Domain Number 4 Region: 887-961
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.32e-21
Family SAM (sterile alpha motif) domain 0.0000281
Further Details:      
 
Domain Number 5 Region: 230-301,339-358
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000174
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004741281.1.14098
Sequence length 963
Comment PREDICTED: ephrin type-B receptor 2 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDSTTATAELGWIVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRRGA
HRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADYDSATKTFPNWMENPWVKVDTIAA
DESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRVIQN
GAVFQETLSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAA
ENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTT
IPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAP
RQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMH
QVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAI
YVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAI
VCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKI
EQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVI
HLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYV
HRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKF
TSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCW
QKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLE
AIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQS
VEV
Download sequence
Identical sequences M3YWX7
XP_004741281.1.14098 ENSMPUP00000015837 ENSMPUP00000015837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]