SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004741733.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004741733.1.14098
Domain Number 1 Region: 858-1021
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.93e-30
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.04
Further Details:      
 
Domain Number 2 Region: 725-809
Classification Level Classification E-value
Superfamily WWE domain 0.000000000131
Family WWE domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004741733.1.14098
Sequence length 1024
Comment PREDICTED: zinc finger CCCH-type antiviral protein 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MADPEVCCFITKVLCAHGGRMALDALLEEIRLPEGQLLEVLEEAGPDRFVLLETGGREGI
TRSVVATTGARVCRRKFCQRPCEDLHLCKLNLLGRCNYTQTDRNLCKYSHNVLSEENFKV
LKNHELSGLNQKELAVLLLQSDPFFMPEICKNYKGEGRKVTCNKYPQCERLHICEHFTRG
NCGYPNCLRSHNLMDRRVLAIMREHGLSSSVVQNIQDICNSKHSPKKHSGHRGPPAYRRD
PAYRGRSKSRDRSFHGSMEFLPSASASTQKSCAAAADQIGHRLPQEDVPVEDLAHKFVHL
GSQDGPQPSPVPPQMDHVRGRSQVGRSQRFSENGSPKDLFYGNQGSVYLPSDSKPASSQK
GPASSLNGKGTGRESLFSQSQAASGSPPGSPQTPDAMTAWKNTGLLSSDGVNAGGRSGKQ
NVQYGPLFNNNVDGTAADTTSTRSFSYKTATSGQREKSLPRSQDARTTHGNVQTTGKVAG
GDDPAVASVNGPCREKTVWANHSVHGTPDSSSQVADETFRVSKTGAAGFDFTLPSRGDKN
ASCFGSQNLEGEVVPTPWETTVPTPQVRTPSKVPSSTSSSSDKSAVYASHGQNSAPVLVS
PASELARTPRYPPYFASDVESTSSSRMADCGSKEICLDHLCRGCQVESCNKVHFHLPYRW
QMWLGNTWMDFQPMETIEKAYCDPQIHTFSIGDKDIDFQKMTCNFNPIRRISTPSSVIVL
TNFVFATRWIWYWKSQSDKWVEYGEEADSHQASSIDSSYLESFFLGHPRGVVAFHVGSQN
YELSFAGMIQTNVASRTQKRVVRRPKFMSYKDVEQIKSGFSYQLAPPRSDPLSPALLPQW
DFGSDGYELSDIPCRVLEYIKIDTYFKASMKNFKVERIRKIKNTKLLSAFERKKMKMNNR
KEEILFYATDHVHLDSICRDNFDWLLHGAGKPKYGKGIYFTKDAIHAHKNCQCDTKNIVM
FVARVLVGDFTQGEMGSISPPPPPYNSYVDIRSNPSVFVIFDKDQIYPEYVIEYTELDKG
CVIS
Download sequence
Identical sequences M3XXH4
XP_004741733.1.14098 ENSMPUP00000003774 ENSMPUP00000003774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]