SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004741964.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004741964.1.14098
Domain Number 1 Region: 52-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.93e-46
Family Ankyrin repeat 0.00028
Further Details:      
 
Domain Number 2 Region: 275-336
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000112
Family SAM (sterile alpha motif) domain 0.021
Further Details:      
 
Domain Number 3 Region: 245-300,385-421
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000968
Family Pseudo ankyrin repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004741964.1.14098
Sequence length 475
Comment PREDICTED: ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MATCTLRGLAVAGGGESSESEDDGWEIGYLDRADQKLKGPLLPEEKNETFKKALTTGDIS
LVQELLDSGISVESSFRYGWTPLMYAASVSNVELVRVLLDRGANASFDKDKQTILITACS
ARGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHPQVVALLVAHGAEVNSQDE
NGYTALTWAARQGHKNVVLKLLELGANKMLQTKDGKTPSEIAKRNKHLEIFNFLSLTLNP
LEGKLQQLTKEETICKLLTTDSDKENDHLFSSYTAFGDLEIFLHGLGLEHMTDLLKERDI
TLRHLLTMRKDEFTKNGITSRDQQKILAALKELEVEEIKFGELPEVAKLEISGDEFLNFL
LKLNKQCGHLITAVQNIITELPVNSHKIVLEWASPRNFTSVCEELVSNVEDLSKEVCKLK
DLIQKLQNERENDPTHIPLMEEVSTWNSKILKRTAIAVCGVGLLLFVCKLTLQRK
Download sequence
Identical sequences M3Y6Z5
ENSMPUP00000007098 XP_004741964.1.14098 ENSMPUP00000007098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]