SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004742006.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004742006.1.14098
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-21
Family THAP domain 0.00043
Further Details:      
 
Weak hits

Sequence:  XP_004742006.1.14098
Domain Number - Region: 335-391
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004742006.1.14098
Sequence length 394
Comment PREDICTED: THAP domain-containing protein 5 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPRYCAAVCCKNRRGRNSKDRKLSFYPFPLHDKERLEKWLKNMKRDSWVPSKYQFLCSDH
FTPDSLDVRWGIRYLKQTAIPTIFSLPEDNQEKDSSKKKSQKKKLDDEKEVCLKAKSQES
FASNELKKNTVNTDILPEHTELLNSSTLVKLPAPKPEGIQNNILTLNLVKQDIKKPVSTL
ETSVTQDIDIGGFHTSFENLNSTTITLTTSNSEDIQPSLETQEVFEITTNHLANPNFTNN
SMEIKSAQESPFLFSTITKTVEELNANKESVIAIFVPTENSKPINSFVSTEKETVEMGDL
DPEGSLYKDIDYETEVLQIEHSYCRQDINKEHLWRKVSKLHSKITLLELQEQQTLGRLKS
LEALIRQLKQEHWLSEENVKIIENHFTTYEVTML
Download sequence
Identical sequences M3Y8T1
ENSMPUP00000007738 ENSMPUP00000007738 XP_004742006.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]