SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004742990.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004742990.1.14098
Domain Number 1 Region: 605-912
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.47e-74
Family WD40-repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 963-1239
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.59e-56
Family WD40-repeat 0.00036
Further Details:      
 
Domain Number 3 Region: 108-368
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.42e-43
Family RecA protein-like (ATPase-domain) 0.064
Further Details:      
 
Domain Number 4 Region: 1-92
Classification Level Classification E-value
Superfamily DEATH domain 3.11e-22
Family Caspase recruitment domain, CARD 0.00000861
Further Details:      
 
Weak hits

Sequence:  XP_004742990.1.14098
Domain Number - Region: 432-486
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.016
Family Cdc48 domain 2-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004742990.1.14098
Sequence length 1250
Comment PREDICTED: apoptotic protease-activating factor 1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDAKARNCLLQHREALEKDIKTSYIMDRMINDGVLTVSEEEKVKNEPTQQQRAALLIKMI
LKKDNYSYISFYNALIHEGYKDLAALLQSGIPVISSSSGGKDSVGGITSYVKTVLCEGGV
PQRPVVFVTRKKLVNAIQQNLLKLNGEPGWVVIYGMAGCGKSVLAAESVRDHFFLDGCFP
GGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSL
LILDDIWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVSVESGLGKEKGLEILSLFV
NMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWDYYLRQLQNKQFKRIRKSSSY
DYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFV
NKSLLFCDRNGKSFCYYLHDLQVDFLIEKNRNQLQNLHRKIITQFQKHYQPHTLSPDQED
CMYWYNFLAYHMGSANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCA
VCENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDHGVLYLEWIN
KKNIKNLSRLVVRPHTDAVYHACFSEDGQRIASCGVDKTLQVFKAETGEKLLEIKAHEDE
VLCCAFSTDDRFIATCSVDKKVKIWNSMTGELVRIYDEHSEQVNCCHFANNSQYLLLATA
SSDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDVKSANERK
SIDVKQFFLNSEEPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTNGLLAEIHTGH
HSTIQYCDFSPQNHLAVVALSQCCVELWNMDSCLKVADCRGHLSWVHCVMFSPDGSSFLT
SSDDQTIRLWETKKVCKNSAIVLKQEIDVVFQENEVMVLAADNIKRLQLINGKTGQIDYL
TEAQVSCCCLSPYLQYIAFGGEDGAIEILELLNNRIFQSRIGHKKTVRHIQFTDDGKTLI
SSSDDSSIQVWNWQSEEYVFLQAHQETVKDFKLLKNSKLLSWSFDGTVKVWSIITGRIEK
DFVCHQDTVLSCDISPDATKFSSTSADKTAKIWSFDLLSPLHELRGHRGCVRCSVFSVDS
TLLATGDDNGEIRIWNVSNGELLHLCAPISVEEGAATHGGWVTDLCFSPDSKMLVSAGGY
LKWWNVVTGESSQTFYTNGTYLKKIHVSPDFKTYVTVDNLGILYILQMLE
Download sequence
Identical sequences M3YJ50
ENSMPUP00000011357 ENSMPUP00000011357 XP_004742988.1.14098 XP_004742989.1.14098 XP_004742990.1.14098 XP_004742991.1.14098 XP_004742992.1.14098 XP_012906957.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]