SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004744777.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004744777.1.14098
Domain Number 1 Region: 535-781
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.87e-63
Family Nuclear receptor ligand-binding domain 0.000000000466
Further Details:      
 
Domain Number 2 Region: 423-504
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.69e-27
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004744777.1.14098
Sequence length 782
Comment PREDICTED: glucocorticoid receptor isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MDSKESLSPPSKEEISSSVLGRERGNVMDFYKTLRGGATVKVSASSPSSLAAASQSDSKQ
QRLLVDFPKGPGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETD
FRLLEESIANLNRSTSVPENPKSSASTAVSAAPMEREFSKTLSDVSSEQQNLKGQTGSNG
GNVKLCTTDQSTFDIWRKKLQDLEFSSGSPENEASESPWKSDLLIDENCLLSPLAGEDDP
FLLEGNSNEDCKPLVLPDTKPKIKDNGELILSSPNSVPLPQVKTEKEDFIELCTPGVIKQ
EKLGPVYCQGSFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASVSQQQDQKPIFNVI
PPIPVGSENWNRCQGSGDDSLASLGTLNFPGRSVFSNGYSSPGMRPDVSSPPSSSSAATG
PPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPA
CRYRKCLQAGMNLEARKTKKKIKGIQQATPGASQETSENPANKTIVPTTLPQLTPTLVSL
LEVIEPEVLYAGYDSSIPDTTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTL
LQYSWMFLMAFALGWRSYRQSSGNVLCFAPDLIINEQRMSLPCMYEQCKHMLFVSSELQR
LQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRF
YQLTKLLDSMHDVVENLLNFCFQTFLDKNMSIEFPEMLAEIITNQIPKYSSGNIKKLLFH
QK
Download sequence
Identical sequences M3Y916
ENSMPUP00000007823 ENSMPUP00000007823 XP_004744777.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]