SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004745076.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004745076.1.14098
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-22
Family PDZ domain 0.00071
Further Details:      
 
Domain Number 2 Region: 281-310
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000252
Family LIM domain 0.0027
Further Details:      
 
Domain Number 3 Region: 249-280
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000233
Family LIM domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004745076.1.14098
Sequence length 331
Comment PREDICTED: PDZ and LIM domain protein 4 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELM
THLEAQNRIKGCHDHLTLSVSRPEGRSWTSAPEDSKAQAQRIHIDPEAQDGSPVTSRRPS
ATGIELEDGRPGLGPPYGQPSHLSFHHNGSSNEATLLTQMSTLHVSPLNSTDTARGLPRS
RDCGVDLGSEVYRMLREPAETLTSEPKQSGSFRYLQGMLEAGEGGERPGSSGARNLKPTA
SKLGTPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDER
LYCESHAKARVKPPEGYDVVAVYPNAKVELV
Download sequence
Identical sequences M3YH22
XP_004745076.1.14098 ENSMPUP00000010629 ENSMPUP00000010629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]