SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004745368.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004745368.1.14098
Domain Number 1 Region: 735-924
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.4e-61
Family Nucleotide and nucleoside kinases 0.000000055
Further Details:      
 
Domain Number 2 Region: 556-670,729-763
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-31
Family SH3-domain 0.0000555
Further Details:      
 
Domain Number 3 Region: 454-553
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-31
Family PDZ domain 0.000025
Further Details:      
 
Domain Number 4 Region: 207-312
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-29
Family PDZ domain 0.000023
Further Details:      
 
Domain Number 5 Region: 313-407
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-26
Family PDZ domain 0.000044
Further Details:      
 
Domain Number 6 Region: 4-63
Classification Level Classification E-value
Superfamily L27 domain 1.41e-21
Family L27 domain 0.0000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004745368.1.14098
Sequence length 927
Comment PREDICTED: disks large homolog 1 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCIDRSKQSEPIQPVNTWEISSLPSTTVTSETLPSSLSPSVEKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVPPSSPTVPVIPVLP
VPAENTVILPTIPQANPPPVLVNTESLETSTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAG
SIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYVPPDIT
NPASQPVDNHVSPSSYLGHTPASPARYSPVSKAMLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRTASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGL
PSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKTRGDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHITSNASDSESSYRGQE
EYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDG
RDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKR
LQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTL
EDIYNQVKQIIEEQSGPYIWVPAKEKL
Download sequence
Identical sequences M3XXD9
ENSMPUP00000003739 ENSMPUP00000003739 XP_004745368.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]