SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004746499.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004746499.1.14098
Domain Number 1 Region: 1068-1268,1306-1355,1382-1474
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.96e-39
Family Rap/Ran-GAP 0.0058
Further Details:      
 
Weak hits

Sequence:  XP_004746499.1.14098
Domain Number - Region: 142-171,503-628,655-696,754-868
Classification Level Classification E-value
Superfamily ARM repeat 0.0115
Family HspBP1 domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004746499.1.14098
Sequence length 1495
Comment PREDICTED: ral GTPase-activating protein subunit beta isoform X3 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MYSEWRSLHLVIQNDQGHTSVLHSYPESVGREVANAVVHPLGQALGTPSVAGSESLLKTD
KEVKWTMEVICYGLTLPLDGETVKYCVDVYTDWIMALVLPKDSIPLPVIKEPNLYVQSIL
KHLQNLFVPRQEQGSSQIRLCLQVLRAIQKLARESSIMARETWEVLLLFLLQINDILLAP
PTVQGGIAENLAEKLIGVLFEVWLLACTRCFPTPPYWKTAKEMVANWRHHPAVVEQWSKV
TCALTSRLLRFTYGPSFPPFKVPDEDASLIPPEMDNECVAQTWFRFLHMLSNPVDLSNPA
IISSTPKFQEQFLNVSGMPQELNQYPCLKHLPQIFFRAMRGISCLVDAFLGISRPRSDSA
PPTPVNRLSMPQSTAVSTTPPHNRRHRAVTVNKATMKTSTVSTAHASKVQHQTSSTSPLS
SPNQTSSEPRPLPAPRRPKVNSILNLFGSWLFDAAFVHCKLHNGINRDSSMTAITTQASM
EFRRKGSQMSTDTMVSNPMFDASEFPDNYEAGRAEACGTLCRIFCSKKTGEEILPAYLSR
FYMLLIQGLQINDYVCHPVLASVILNSPPLFCCDLKGIDVVVPYFISALETILPDRELSK
FKSYVNPTELRRSSINILLSLLPLPHHFGTVRSEVVLEGKFSNDDSSSYDKPITFLSLKL
RLVNILIGALQTETDPNNTQMILGAMLNIVQDSALLEAIGCQMEMGGGENNLKSHSRTNS
GISSASGGSTEPTTPDSERPAQALLRDYALNTDSAAGLLIRSIHLVTQRLNSQWRQDMSI
SLAALELLSGLAKVKVMVDSGDRKRAISSVCSYIVYQCSRPAPLHSRDLHSMIVAAFQCL
CVWLTEHPDMLDEKDCLKEVLEIVELGISGSKSKNSEQEVKYKGDKEPNPASMRVKDAAE
ATLTCIMQLLGAFPSPSGPASPCSLVNETTLIKYSRLPTINKHSFRYFVLDNSVILAMLE
QPLGNEQNDFFPSVTVLVRGMSGRLAWAQQLCLLPRGAKANQKLFVPEPRPVPKNDVGFK
YTVKHRPFPEEVDKIPFVKADLSIPDLHEIVTEELEERHEKLRNGMTQQIAYEVHLEQQS
EEELRKRSFPDPVTDCKPPPPAQEFQTARLFLSHFGFLSLEALKEPANSRLPPHLIALDS
TIPGFFDDIGYLDLLPCRPFDTVFIFYMKPGQKTNQEILKNVESSRNVQPHFLEFLLSLG
WSVDVGRHPGWTGHVSTSWSINSCDNGEGPEQDEVISSEDVGASIFNGQKKVLYYADALT
EIAFVVPSPVESLTDSLESNISDQDSDSNMDLMPGILKQPSLTLELFPNHTDNLNSSQRL
SPSSRMKKLPQGRPVPPLGPETRVSVVWVERYDDIENFPLSDLLTEISTGVETTANSSTS
LRSTTLEKEVPVIFIHPLNTGLFRIKIQGATGKFNMVIPLVDGMIVSRRALGFLVRQTVI
NICRRKRLESDSYSPPHVRRKQKITDIVNKYRNKQLEPEFYTSLFQEVGLKNCTS
Download sequence
Identical sequences M3Z216
ENSMPUP00000017628 XP_004746499.1.14098 ENSMPUP00000017628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]