SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004747402.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004747402.1.14098
Domain Number 1 Region: 694-779
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.03e-16
Family Tudor domain 0.0034
Further Details:      
 
Domain Number 2 Region: 559-646
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Weak hits

Sequence:  XP_004747402.1.14098
Domain Number - Region: 751-858
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00602
Family Staphylococcal nuclease 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004747402.1.14098
Sequence length 861
Comment PREDICTED: A-kinase anchor protein 1, mitochondrial [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MAIQFRSLFPLALPGMLAVLGWWWFFSRKKHVSSQDRQVEAGAVERRAGCAIKEPRARED
PCPGVVSPPPSIGALAEKEPSAVSKPPSEPPALLRPHASCRRSESSGSLPNITDTRLRPG
TRRDDSAKVELALTGDEAGSVPPECPLPTPKNVPFPHVATEVCKQEALFSATGGRGWQGQ
AAAPQEKPRETGGAEGTGDAVSGESLPEESVLYQEHDSDSEICKAPSPGEKRQDRPPQTE
DDAVGKLLSSLIESAHAELMEDDELRAPQVGDRAGDADGAGGPGKEEAVEQNEKIEQAAY
QIISRVILEATEEVLATTVGRITDRVYQASAGQLQGQKEESSGPVCQKSSPGQDAGEPAP
ATVEPEAASGADATLPSPGLPTEDLPPPKTYKSCLSSPLSSPTKDRKPKNSAHHISLAPC
PLPAVPQGESPDEASVLVQNAGCVPCVPCTSDSGQDVRSVASEQCSDSTSTSGLEDLCTD
TNSSPRSKAISPPLPESTVPFSNGVLKGELSDLGNEDGWTVDAEADHSGGSDGNSMDSVD
GCCGPRKTDSFQNAQVGSSPKKVDLIIWEIEVPKHLVGRLIGKQGRYVSFLKQTSGAKIY
ISTLPYTQNIQICHIEGSQHHVDKALNLIGKKFKELNLTNIYAPPLPSLALPSLPMTSWL
MLPDGVTVEVIVVNQVNAGHLFVQQHTHPTFHALRSLDQQMCLCYSQPGIPTLPTPVEVT
VICAAPGVDGAWWRAQVVASYEESNEVEIRYVDYGGYKRVKVDVLRQIRSDFVTLPFQGA
EVLLDSVMPLSDDDHFSPEADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGNEAVL
INRSLVERGLAQWVDSYYASL
Download sequence
Identical sequences M3YVB0
ENSMPUP00000015270 ENSMPUP00000015270 XP_004747400.2.14098 XP_004747402.1.14098 XP_012909122.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]