SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004747464.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004747464.1.14098
Domain Number 1 Region: 214-547
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.61e-111
Family Motor proteins 0.0000000413
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000021
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004747464.1.14098
Sequence length 1365
Comment PREDICTED: kinesin-like protein KIF24 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MTSWLYECLCEAELAQYYPHFTALGLQKIDELAKVTMKDYSKLGVRDMNDRKRLFQLIKI
IKIMQEEDKAVNSPEHPLQTDSLCSKPRESRSGPRRQLHFDSPADNKDRTTSNSGFERHS
LSDFSANEQKSSYLKVLEHMLPDDSHYHTKTRILSAAAAGSYVQTETNTSLFSSNHYSPL
LGDCDGPIIQRVSHVSGYNYGIPHSCIRQNTSEKENPWTEMEKIRVCVRKRPLGMREVRR
GEINIITVENKETLLVHEKKEAVDLTQYILQHVFYFDEVFGEACTNRDVYMKTTHPLIQH
IFNGGNATCFAYGQTGAGKTYTMIGTHQNPGLYALAAKDIFRQLEVSQPRRPLFVWISFY
EIYCGQLYDLLNRRKRLFAREDSKHVIQIVGLQELQVDSVDLLLEVILKGSKERSTGATG
VNADSSRSHAIIQIQIKDSAKRTFGRISFIDLAGSERAADARDSDRQTKMEGAEINQSLL
ALKECIRALDQEHTHTPFRQSKLTQVLRDSFIGDAKTCMIANISPSHVATEHTLNTLRYA
DRVKELKKGVKCCTSATSRNQTSGNSSPKRIQSSPVALPGDKCSPKKVKLGLQQSFMAAP
GSTKGKAYPLASHPPNIPFAPVPKVPGKTGSSRGSPPQEWVVQTSPVKGATQSRHSAKKR
AEESAPLCCEKNQMGNRTARRWGSKAAGPGEAPARGKLPSKCKTVQPVQPVQRQLVSRAE
LSSGSLHHLAKSGQGSKGSTPARPASEVWTDIPPHQKEREEHLRFYHQQFQQPPLLQQKF
NYQPLERFLCQYRPLEGQFQNETPLPFCSYSESQDGAHAEDLDDSDFSEDSFSHVSSQRT
TKQRNTLENSEGSFFLHQREEGAAEVAERQQSLLFNPRTDGDEKGPTGNWMYSRNPTNYR
GAALSHGHGSSKVTLDCSREESSSLELSPRDNPTEKPYCSQVDFVCGRKGGGDPPSELRQ
NAFRSEAPGQAEGSSLPPEEDSFIFSLSHEAFPGSPDQRETVSTPLREVGQDSPTLVTET
MKNSYPYQEGNCRGESGTCSEYASGLMAPLTVSLLENTDDEGPLPLERLAQDGLAHSPVA
AGGPPVGNTVSSGDQKALLPVSSAAGHLWLSSSPPDNKPNGDLPALSPSPIRQHPPETLP
ISETDPGEVCQSREPVLSSQEHSSSKQCDADAEAAELSSSQGFPEKPFPHIHIGGPHPAP
LLTARTESSVMADQPWAQERKSPKGLGWQELSLLRDPIIKLPCYNSNIMWLKYRPIPRCL
ARPGSPLAPGSSPETAGTLPQLTLGPAQQVVIRAHQEQLDKMAELVFKEETLMSQLALHD
FEDFVTQLDEILALKSQCIQGLRSQLQLYRACHRPATAPERTVVA
Download sequence
Identical sequences M3XYI6
ENSMPUP00000004137 ENSMPUP00000004137 XP_004747464.1.14098 XP_004747465.1.14098 XP_004747466.1.14098 XP_004747467.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]