SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004747715.1.14098 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004747715.1.14098
Domain Number 1 Region: 935-1028
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.35e-18
Family Tudor domain 0.0018
Further Details:      
 
Domain Number 2 Region: 491-582
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.86e-18
Family Tudor domain 0.0025
Further Details:      
 
Domain Number 3 Region: 676-776
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.13e-16
Family Tudor domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004747715.1.14098
Sequence length 1098
Comment PREDICTED: tudor domain-containing protein 7 isoform X1 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence
MLEADLVSKMLRAVLQSHKNGIALPRLQGEYRSLTGDWIPFKQLGYPTLEAYLRSVPAVV
RIETSRSGEITCYAMACTETARIAQLVARQRSSKRKTGRQVNCQMRVKKTMPFFLEGKPK
ATLRQPGISSDFSISKKPNPTLLRDKGNSLGIKSDAEMPPYTLHTTIGSDVFKDVPGQRH
VTIPTNNRFSPKASLPPPFQMHLSRTCAKEVSDNLNQTVEKPNVTPPASYTYKMDEVQNR
IKEILNKHNNGIWISKLPHFYKELYKEELNQGILQQFEHWPHICTVEKPCSGGQDLLLYP
AKRKQLLRGELDGEKVPPSPLPAPKPIPPLKECPTVIPGDLKEKVAELLAKYSSGLWASA
LPKAFEDMYKVKFPEDALKNLASFSDVCTIDYISGNPQKAILYAKLPLPTDKILKDAGQA
HGDYDIKSMIEQEYLQIEENIAKCADTFVENIAVPPLIIPTEASPSVLVVELSNTNEVVI
RYVGKDYSAAQELMEDEMKEYYSKNPKVTPVQTVHVGQLLAVNAEEDAWLRAQIISMDEN
KIKVCYVDYGFSENIEKSKAYKLNPKFCSLSFQATKCKLAGLEVLSDDPDLVKVVESLTC
GKIFAVEILEKADIPLVVLYDTSGEDDVNINATCLKAICDKSLEAHLQIDAMYTNVRVTN
ICSDGTLYCQVPCKGLNKLNDLLHKIEDYFHCKHMTSEYFVSLPFCGKVCLFHCKGKWLR
VEITNVHSSRALDVQFLDSGTVTSVKVSELREIPPRFLQEIIVIPPQAIKCCLADLPQSI
GMWTPDAVLWLRDSVLNCSDCSIKVTKVDETRGIAHIYLFTPKNFPDPHRSINRQITNAD
LWKHQKDVFLSAVSSGTSSPNSKSGGTPVLGNTGENFRKNLTDAIKKSVVDHSSSFSTEE
LPPPVHLSKPGEHMDVYVPVACHPGYFVIQPWQEIHKLEVLMEEMILYYSVSEERHIAVE
KDQVYAAKVENKWHRVLLKGILTNGLVSVYELDYGKHELVNIRKVQPLVDMFRKLPFQAV
TAQLAGVKCNQWSEEASMVFRNHVEKKPLVALVQTVIENANPWDRKVVVYLVDTSLPDTD
IWIHDFMSEYLVELSKVN
Download sequence
Identical sequences M3Y4R1
ENSMPUP00000006312 XP_004747715.1.14098 ENSMPUP00000006312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]